BLASTX nr result
ID: Cinnamomum23_contig00055813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00055813 (418 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_006618141.1| RNA-binding protein [Arthrospira platensis] ... 53 4e-07 ref|WP_014274584.1| RNA-binding protein [Arthrospira platensis] ... 51 2e-06 ref|WP_006670338.1| MULTISPECIES: RNA-binding protein [Arthrospi... 51 3e-06 gb|EKD06505.1| RNP-1 like RNA-binding protein [Arthrospira plate... 51 3e-06 ref|WP_004161448.1| RNA-binding protein [Microcystis aeruginosa]... 47 4e-06 ref|WP_002769876.1| RNA-binding protein [Microcystis aeruginosa]... 47 6e-06 ref|WP_015227980.1| RNA-binding protein [Dactylococcopsis salina... 50 8e-06 >ref|WP_006618141.1| RNA-binding protein [Arthrospira platensis] gi|647981127|gb|KDR58077.1| RNA-binding protein [Arthrospira platensis str. Paraca] Length = 93 Score = 52.8 bits (125), Expect(2) = 4e-07 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = -1 Query: 337 RNGGFGFVRFKSENEALKAIDRMNGCKWGGRTIVVNLARPRTRNR 203 R+ GFGFV SE+E AID ++G +W GR++ VN ARPR NR Sbjct: 40 RSRGFGFVEMSSEDEEKVAIDALDGAEWKGRSLKVNKARPRDNNR 84 Score = 27.7 bits (60), Expect(2) = 4e-07 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 410 ELEAMFCWAGRIVDSFIPIDRITGKKRG 327 +L A F G + S IP DR TG+ RG Sbjct: 16 DLSAAFAEYGTVKRSMIPTDRETGRSRG 43 >ref|WP_014274584.1| RNA-binding protein [Arthrospira platensis] gi|291566709|dbj|BAI88981.1| RNA-binding protein [Arthrospira platensis NIES-39] Length = 93 Score = 50.8 bits (120), Expect(2) = 2e-06 Identities = 23/45 (51%), Positives = 31/45 (68%) Frame = -1 Query: 337 RNGGFGFVRFKSENEALKAIDRMNGCKWGGRTIVVNLARPRTRNR 203 R+ GFGFV SE+E AI+ ++G +W GR++ VN ARPR NR Sbjct: 40 RSRGFGFVEMSSEDEEKVAINALDGAEWKGRSLKVNKARPRDNNR 84 Score = 27.7 bits (60), Expect(2) = 2e-06 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 410 ELEAMFCWAGRIVDSFIPIDRITGKKRG 327 +L A F G + S IP DR TG+ RG Sbjct: 16 DLSAAFAEYGTVKRSMIPTDRETGRSRG 43 >ref|WP_006670338.1| MULTISPECIES: RNA-binding protein [Arthrospira] gi|209492382|gb|EDZ92725.1| RNP-1 like RNA-binding protein [Arthrospira maxima CS-328] gi|375328318|emb|CCE16854.1| Glycine-rich RNA-binding protein, rbp-like [Arthrospira sp. PCC 8005] gi|585305808|emb|CDM95436.1| Glycine-rich RNA-binding protein, rbp-like [Arthrospira sp. PCC 8005] Length = 93 Score = 50.8 bits (120), Expect(2) = 3e-06 Identities = 22/45 (48%), Positives = 32/45 (71%) Frame = -1 Query: 337 RNGGFGFVRFKSENEALKAIDRMNGCKWGGRTIVVNLARPRTRNR 203 R+ GFGFV +E+E KAI+ ++G +W GR++ VN ARPR N+ Sbjct: 40 RSRGFGFVEMVNEDEETKAIEALDGAEWMGRSLKVNKARPRENNK 84 Score = 26.9 bits (58), Expect(2) = 3e-06 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 410 ELEAMFCWAGRIVDSFIPIDRITGKKRG 327 +L +F G + S IP DR TG+ RG Sbjct: 16 DLSEVFAQYGTVKRSMIPTDRETGRSRG 43 >gb|EKD06505.1| RNP-1 like RNA-binding protein [Arthrospira platensis C1] Length = 86 Score = 50.8 bits (120), Expect(2) = 3e-06 Identities = 22/45 (48%), Positives = 32/45 (71%) Frame = -1 Query: 337 RNGGFGFVRFKSENEALKAIDRMNGCKWGGRTIVVNLARPRTRNR 203 R+ GFGFV +E+E KAI+ ++G +W GR++ VN ARPR N+ Sbjct: 33 RSRGFGFVEMVNEDEETKAIEALDGAEWMGRSLKVNKARPRENNK 77 Score = 26.9 bits (58), Expect(2) = 3e-06 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 410 ELEAMFCWAGRIVDSFIPIDRITGKKRG 327 +L +F G + S IP DR TG+ RG Sbjct: 9 DLSEVFAQYGTVKRSMIPTDRETGRSRG 36 >ref|WP_004161448.1| RNA-binding protein [Microcystis aeruginosa] gi|389803795|emb|CCI17308.1| putative RNA-binding protein rbpB [Microcystis aeruginosa PCC 9807] Length = 100 Score = 47.0 bits (110), Expect(2) = 4e-06 Identities = 21/41 (51%), Positives = 27/41 (65%) Frame = -1 Query: 328 GFGFVRFKSENEALKAIDRMNGCKWGGRTIVVNLARPRTRN 206 GFGFV S+ E KAI+ ++G +W GR + VN ARPR N Sbjct: 43 GFGFVEMSSDEEEAKAIETLDGAEWMGRQMKVNKARPREDN 83 Score = 30.4 bits (67), Expect(2) = 4e-06 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -3 Query: 416 KLELEAMFCWAGRIVDSFIPIDRITGKKRG 327 K +L+ +F G +V ++P+D+ TGK RG Sbjct: 14 KEDLQGVFAEYGTVVRVYLPVDQATGKMRG 43 >ref|WP_002769876.1| RNA-binding protein [Microcystis aeruginosa] gi|389732378|emb|CCI03686.1| putative RNA-binding protein rbpB [Microcystis aeruginosa PCC 9443] Length = 100 Score = 47.0 bits (110), Expect(2) = 6e-06 Identities = 21/41 (51%), Positives = 27/41 (65%) Frame = -1 Query: 328 GFGFVRFKSENEALKAIDRMNGCKWGGRTIVVNLARPRTRN 206 GFGFV S+ E KAI+ ++G +W GR + VN ARPR N Sbjct: 43 GFGFVEMSSDEEEAKAIETLDGAEWMGRQMKVNKARPREDN 83 Score = 29.6 bits (65), Expect(2) = 6e-06 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 416 KLELEAMFCWAGRIVDSFIPIDRITGKKRG 327 K +L +F G +V ++P+D+ TGK RG Sbjct: 14 KEDLHGVFAEYGTVVRVYLPVDQATGKMRG 43 >ref|WP_015227980.1| RNA-binding protein [Dactylococcopsis salina] gi|428692817|gb|AFZ48967.1| RRM domain-containing RNA-binding protein [Dactylococcopsis salina PCC 8305] Length = 99 Score = 50.1 bits (118), Expect(2) = 8e-06 Identities = 22/41 (53%), Positives = 30/41 (73%) Frame = -1 Query: 328 GFGFVRFKSENEALKAIDRMNGCKWGGRTIVVNLARPRTRN 206 GFGFV +SE+E + AI+ ++G +W GR + VN ARPRT N Sbjct: 43 GFGFVELESESEEVSAIEVLDGAEWMGRELRVNKARPRTEN 83 Score = 26.2 bits (56), Expect(2) = 8e-06 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 410 ELEAMFCWAGRIVDSFIPIDRITGKKRG 327 EL +F G + IP+DR TGK RG Sbjct: 16 ELNEVFADYGTVKRVTIPVDRETGKVRG 43