BLASTX nr result
ID: Cinnamomum23_contig00055810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00055810 (309 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007674559.1| hypothetical protein BAUCODRAFT_57635, parti... 59 1e-06 >ref|XP_007674559.1| hypothetical protein BAUCODRAFT_57635, partial [Baudoinia compniacensis UAMH 10762] gi|449301862|gb|EMC97871.1| hypothetical protein BAUCODRAFT_57635, partial [Baudoinia compniacensis UAMH 10762] Length = 218 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 309 LRITTEDLYCHFEPFLAPIRIWQQQQAEKK 220 LRIT EDLYCHFEPFLAPIR+WQ +QAEK+ Sbjct: 164 LRITEEDLYCHFEPFLAPIRLWQARQAEKQ 193