BLASTX nr result
ID: Cinnamomum23_contig00055748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00055748 (241 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIW05820.1| hypothetical protein PV09_03026 [Verruconis gallo... 157 2e-36 ref|XP_007781384.1| hypothetical protein W97_05310 [Coniosporium... 146 6e-33 ref|XP_003834342.1| hypothetical protein LEMA_P060110.1 [Leptosp... 145 1e-32 ref|XP_008028152.1| hypothetical protein SETTUDRAFT_42747 [Setos... 144 2e-32 ref|XP_001802992.1| hypothetical protein SNOG_12774 [Phaeosphaer... 144 2e-32 ref|XP_007689189.1| hypothetical protein COCMIDRAFT_37850 [Bipol... 144 2e-32 ref|XP_007718361.1| hypothetical protein COCCADRAFT_41917 [Bipol... 144 2e-32 gb|EMD94063.1| hypothetical protein COCHEDRAFT_1192217 [Bipolari... 144 2e-32 ref|XP_007701055.1| hypothetical protein COCSADRAFT_38035 [Bipol... 144 2e-32 ref|XP_003295802.1| hypothetical protein PTT_03062 [Pyrenophora ... 144 3e-32 ref|XP_001941443.1| scaffold protein Scd2 [Pyrenophora tritici-r... 144 3e-32 gb|KKY13135.1| putative protein kinase activator [Diplodia seriata] 142 7e-32 ref|XP_007588526.1| putative protein kinase activator bem1 prote... 142 7e-32 gb|EKG10136.1| Neutrophil cytosol factor 2 p67phox [Macrophomina... 142 7e-32 gb|KIN00433.1| hypothetical protein OIDMADRAFT_42343 [Oidiodendr... 125 1e-26 ref|XP_007804833.1| hypothetical protein EPUS_01906 [Endocarpon ... 125 1e-26 gb|KKY21535.1| putative protein kinase activator [Phaeomoniella ... 124 2e-26 gb|KKA27289.1| hypothetical protein TD95_003467 [Thielaviopsis p... 123 5e-26 gb|ETS04790.1| protein kinase activator [Trichoderma reesei RUT ... 123 5e-26 ref|XP_007289951.1| SH3 domain-containing protein [Marssonina br... 123 5e-26 >gb|KIW05820.1| hypothetical protein PV09_03026 [Verruconis gallopava] Length = 602 Score = 157 bits (398), Expect = 2e-36 Identities = 72/80 (90%), Positives = 75/80 (93%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 ASVPRYCFADD FWFIVE QM+DGRHWELQRLYQDFYDLQINLIQE P EAGNV G+ERT Sbjct: 319 ASVPRYCFADDTFWFIVECQMEDGRHWELQRLYQDFYDLQINLIQEHPLEAGNVKGHERT 378 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LP+MPGPVTYVTDNISNGRR Sbjct: 379 LPYMPGPVTYVTDNISNGRR 398 >ref|XP_007781384.1| hypothetical protein W97_05310 [Coniosporium apollinis CBS 100218] gi|494829426|gb|EON66067.1| hypothetical protein W97_05310 [Coniosporium apollinis CBS 100218] Length = 646 Score = 146 bits (368), Expect = 6e-33 Identities = 68/80 (85%), Positives = 72/80 (90%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 A VPRYCFADDIFWFI+E QM+DGRHWEL RLYQDFYDLQI LIQEFP EAGN G ER+ Sbjct: 339 ACVPRYCFADDIFWFIIECQMEDGRHWELSRLYQDFYDLQIALIQEFPLEAGN-SGVERS 397 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LP+MPGPVTYVTDNISNGRR Sbjct: 398 LPYMPGPVTYVTDNISNGRR 417 >ref|XP_003834342.1| hypothetical protein LEMA_P060110.1 [Leptosphaeria maculans JN3] gi|312210891|emb|CBX90977.1| hypothetical protein LEMA_P060110.1 [Leptosphaeria maculans JN3] Length = 849 Score = 145 bits (366), Expect = 1e-32 Identities = 66/80 (82%), Positives = 70/80 (87%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 A+VPRYCFADDIFWFI+E QM+DGRHWELQRLYQDFYDLQI LI +P EAG ERT Sbjct: 553 ATVPRYCFADDIFWFIIECQMEDGRHWELQRLYQDFYDLQIQLIANYPVEAGTSGSSERT 612 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LPFMPGPVTYVTDNISNGRR Sbjct: 613 LPFMPGPVTYVTDNISNGRR 632 >ref|XP_008028152.1| hypothetical protein SETTUDRAFT_42747 [Setosphaeria turcica Et28A] gi|482806961|gb|EOA84013.1| hypothetical protein SETTUDRAFT_42747 [Setosphaeria turcica Et28A] Length = 600 Score = 144 bits (364), Expect = 2e-32 Identities = 66/80 (82%), Positives = 69/80 (86%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 A VPRYCFADDIFWFI+E QM+DGRHWELQRLYQDFYDLQI LI +P EAG ERT Sbjct: 309 ACVPRYCFADDIFWFIIECQMEDGRHWELQRLYQDFYDLQIQLIASYPVEAGTSGSAERT 368 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LPFMPGPVTYVTDNISNGRR Sbjct: 369 LPFMPGPVTYVTDNISNGRR 388 >ref|XP_001802992.1| hypothetical protein SNOG_12774 [Phaeosphaeria nodorum SN15] gi|160703761|gb|EAT80072.2| hypothetical protein SNOG_12774 [Phaeosphaeria nodorum SN15] Length = 624 Score = 144 bits (364), Expect = 2e-32 Identities = 66/80 (82%), Positives = 70/80 (87%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 A+VPRYCFADDIFWFI+E QM+DGRHWELQRLYQDFYDLQI LI +P EAG ERT Sbjct: 327 ANVPRYCFADDIFWFIIECQMEDGRHWELQRLYQDFYDLQIQLIATYPVEAGTSGSGERT 386 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LPFMPGPVTYVTDNISNGRR Sbjct: 387 LPFMPGPVTYVTDNISNGRR 406 >ref|XP_007689189.1| hypothetical protein COCMIDRAFT_37850 [Bipolaris oryzae ATCC 44560] gi|576930724|gb|EUC44299.1| hypothetical protein COCMIDRAFT_37850 [Bipolaris oryzae ATCC 44560] Length = 599 Score = 144 bits (363), Expect = 2e-32 Identities = 66/80 (82%), Positives = 69/80 (86%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 A VPRYCFADDIFWFI+E QM+DGRHWELQRLYQDFYDLQI LI +P EAG ERT Sbjct: 308 ACVPRYCFADDIFWFIIECQMEDGRHWELQRLYQDFYDLQIQLIASYPVEAGTSGSGERT 367 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LPFMPGPVTYVTDNISNGRR Sbjct: 368 LPFMPGPVTYVTDNISNGRR 387 >ref|XP_007718361.1| hypothetical protein COCCADRAFT_41917 [Bipolaris zeicola 26-R-13] gi|576912818|gb|EUC27337.1| hypothetical protein COCCADRAFT_41917 [Bipolaris zeicola 26-R-13] gi|578488575|gb|EUN26017.1| hypothetical protein COCVIDRAFT_38640 [Bipolaris victoriae FI3] Length = 599 Score = 144 bits (363), Expect = 2e-32 Identities = 66/80 (82%), Positives = 69/80 (86%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 A VPRYCFADDIFWFI+E QM+DGRHWELQRLYQDFYDLQI LI +P EAG ERT Sbjct: 308 ACVPRYCFADDIFWFIIECQMEDGRHWELQRLYQDFYDLQIQLIASYPVEAGTSGSGERT 367 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LPFMPGPVTYVTDNISNGRR Sbjct: 368 LPFMPGPVTYVTDNISNGRR 387 >gb|EMD94063.1| hypothetical protein COCHEDRAFT_1192217 [Bipolaris maydis C5] gi|477590561|gb|ENI07635.1| hypothetical protein COCC4DRAFT_48726 [Bipolaris maydis ATCC 48331] Length = 599 Score = 144 bits (363), Expect = 2e-32 Identities = 66/80 (82%), Positives = 69/80 (86%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 A VPRYCFADDIFWFI+E QM+DGRHWELQRLYQDFYDLQI LI +P EAG ERT Sbjct: 308 ACVPRYCFADDIFWFIIECQMEDGRHWELQRLYQDFYDLQIQLIASYPVEAGTSGSGERT 367 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LPFMPGPVTYVTDNISNGRR Sbjct: 368 LPFMPGPVTYVTDNISNGRR 387 >ref|XP_007701055.1| hypothetical protein COCSADRAFT_38035 [Bipolaris sorokiniana ND90Pr] gi|451849852|gb|EMD63155.1| hypothetical protein COCSADRAFT_38035 [Bipolaris sorokiniana ND90Pr] Length = 599 Score = 144 bits (363), Expect = 2e-32 Identities = 66/80 (82%), Positives = 69/80 (86%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 A VPRYCFADDIFWFI+E QM+DGRHWELQRLYQDFYDLQI LI +P EAG ERT Sbjct: 308 ACVPRYCFADDIFWFIIECQMEDGRHWELQRLYQDFYDLQIQLIASYPVEAGTSGSGERT 367 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LPFMPGPVTYVTDNISNGRR Sbjct: 368 LPFMPGPVTYVTDNISNGRR 387 >ref|XP_003295802.1| hypothetical protein PTT_03062 [Pyrenophora teres f. teres 0-1] gi|311332594|gb|EFQ96101.1| hypothetical protein PTT_03062 [Pyrenophora teres f. teres 0-1] Length = 607 Score = 144 bits (362), Expect = 3e-32 Identities = 66/80 (82%), Positives = 69/80 (86%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 A VPRYCFADDIFWFI+E QM+DGRHWELQRLYQDFYDLQI LI +P EAG ERT Sbjct: 317 ACVPRYCFADDIFWFIIECQMEDGRHWELQRLYQDFYDLQIQLIATYPVEAGTSGAGERT 376 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LPFMPGPVTYVTDNISNGRR Sbjct: 377 LPFMPGPVTYVTDNISNGRR 396 >ref|XP_001941443.1| scaffold protein Scd2 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977536|gb|EDU44162.1| scaffold protein Scd2 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 597 Score = 144 bits (362), Expect = 3e-32 Identities = 66/80 (82%), Positives = 69/80 (86%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 A VPRYCFADDIFWFI+E QM+DGRHWELQRLYQDFYDLQI LI +P EAG ERT Sbjct: 307 ACVPRYCFADDIFWFIIECQMEDGRHWELQRLYQDFYDLQIQLIATYPVEAGTSGAGERT 366 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LPFMPGPVTYVTDNISNGRR Sbjct: 367 LPFMPGPVTYVTDNISNGRR 386 >gb|KKY13135.1| putative protein kinase activator [Diplodia seriata] Length = 616 Score = 142 bits (359), Expect = 7e-32 Identities = 65/80 (81%), Positives = 70/80 (87%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 ASVPRYCFA+DIFWFIVE QM+DG +WEL RLYQDFYDLQI LI FP EAG V G ERT Sbjct: 313 ASVPRYCFANDIFWFIVECQMEDGSYWELSRLYQDFYDLQIKLINAFPLEAGQVEGVERT 372 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LP+MPGPVTYVTDNI+NGRR Sbjct: 373 LPYMPGPVTYVTDNITNGRR 392 >ref|XP_007588526.1| putative protein kinase activator bem1 protein [Neofusicoccum parvum UCRNP2] gi|485916813|gb|EOD43991.1| putative protein kinase activator bem1 protein [Neofusicoccum parvum UCRNP2] Length = 610 Score = 142 bits (359), Expect = 7e-32 Identities = 65/80 (81%), Positives = 70/80 (87%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 ASVPRYCFA+DIFWFIVE QM+DG +WEL RLYQDFYDLQI LI FP EAG V G ERT Sbjct: 308 ASVPRYCFANDIFWFIVECQMEDGSYWELSRLYQDFYDLQIKLINAFPLEAGQVEGVERT 367 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LP+MPGPVTYVTDNI+NGRR Sbjct: 368 LPYMPGPVTYVTDNITNGRR 387 >gb|EKG10136.1| Neutrophil cytosol factor 2 p67phox [Macrophomina phaseolina MS6] Length = 607 Score = 142 bits (359), Expect = 7e-32 Identities = 65/80 (81%), Positives = 70/80 (87%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 ASVPRYCFA+DIFWFIVE QM+DG +WEL RLYQDFYDLQI LI FP EAG V G ERT Sbjct: 306 ASVPRYCFANDIFWFIVECQMEDGSYWELSRLYQDFYDLQIKLINAFPLEAGQVEGVERT 365 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LP+MPGPVTYVTDNI+NGRR Sbjct: 366 LPYMPGPVTYVTDNITNGRR 385 >gb|KIN00433.1| hypothetical protein OIDMADRAFT_42343 [Oidiodendron maius Zn] Length = 631 Score = 125 bits (314), Expect = 1e-26 Identities = 51/80 (63%), Positives = 66/80 (82%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 A +PRYCFA+D +WF++E Q++DGRHWEL R Y+DFYD QI+L++EFP EAGN +RT Sbjct: 349 AKIPRYCFAEDKYWFVIEAQLEDGRHWELSRYYEDFYDFQISLLREFPAEAGNTGTQKRT 408 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LP+MPGPV YVTD I+ GR+ Sbjct: 409 LPYMPGPVNYVTDAITEGRQ 428 >ref|XP_007804833.1| hypothetical protein EPUS_01906 [Endocarpon pusillum Z07020] gi|539432716|gb|ERF69576.1| hypothetical protein EPUS_01906 [Endocarpon pusillum Z07020] Length = 576 Score = 125 bits (314), Expect = 1e-26 Identities = 56/80 (70%), Positives = 67/80 (83%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 AS+PRYCF +D++W+I+E QM+DGRHWEL R Y DFYD QI L++EFP+EAGN G RT Sbjct: 285 ASLPRYCFDNDMYWYIIECQMEDGRHWELSRYYADFYDFQIALLKEFPEEAGN-RGSPRT 343 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LPFMPGPV +VTD ISNGRR Sbjct: 344 LPFMPGPVAHVTDAISNGRR 363 >gb|KKY21535.1| putative protein kinase activator [Phaeomoniella chlamydospora] Length = 606 Score = 124 bits (312), Expect = 2e-26 Identities = 55/80 (68%), Positives = 65/80 (81%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 AS+PRYCF +D++WFI+E +M+DGRHWEL R Y DFYD QI L+ EFP EAGN G RT Sbjct: 312 ASIPRYCFDNDMYWFIIECEMEDGRHWELSRYYADFYDFQIALLNEFPDEAGN-NGKPRT 370 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LPFMPGPV ++TD ISNGRR Sbjct: 371 LPFMPGPVAHITDAISNGRR 390 >gb|KKA27289.1| hypothetical protein TD95_003467 [Thielaviopsis punctulata] Length = 600 Score = 123 bits (308), Expect = 5e-26 Identities = 51/79 (64%), Positives = 63/79 (79%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 A +PRYCFAD+ +WF++E ++DGR WEL R Y+DFYD QI L+ EFP EAGNVP +RT Sbjct: 343 ARIPRYCFADEKYWFVIEASLEDGRRWELSRYYEDFYDFQIALLTEFPAEAGNVPNKKRT 402 Query: 60 LPFMPGPVTYVTDNISNGR 4 LP+MPGPV YVTD I+ GR Sbjct: 403 LPYMPGPVNYVTDAITEGR 421 >gb|ETS04790.1| protein kinase activator [Trichoderma reesei RUT C-30] Length = 576 Score = 123 bits (308), Expect = 5e-26 Identities = 51/79 (64%), Positives = 64/79 (81%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 A +PRYCFA+D +WF++E Q++DGRHWEL R Y+DFYD QI L+ EFP EAGN +RT Sbjct: 304 ARIPRYCFAEDKYWFVIETQLEDGRHWELSRYYEDFYDFQIALLTEFPAEAGNTGTQKRT 363 Query: 60 LPFMPGPVTYVTDNISNGR 4 LP+MPGPV+YVTD I+ GR Sbjct: 364 LPYMPGPVSYVTDAITEGR 382 >ref|XP_007289951.1| SH3 domain-containing protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406867071|gb|EKD20110.1| SH3 domain-containing protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 772 Score = 123 bits (308), Expect = 5e-26 Identities = 51/80 (63%), Positives = 64/80 (80%) Frame = -2 Query: 240 ASVPRYCFADDIFWFIVEVQMDDGRHWELQRLYQDFYDLQINLIQEFPQEAGNVPGYERT 61 A +PRYCFA+D +WF++E ++DGRHWEL R Y+DFYD QI L+ EFP EAGN G +RT Sbjct: 486 AKIPRYCFAEDKYWFVIEAALEDGRHWELSRYYEDFYDFQIALLTEFPAEAGNNMGQKRT 545 Query: 60 LPFMPGPVTYVTDNISNGRR 1 LP+MPGPV YVTD I+ GR+ Sbjct: 546 LPYMPGPVNYVTDAITEGRQ 565