BLASTX nr result
ID: Cinnamomum23_contig00055640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00055640 (323 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM83602.1| hypothetical protein ANO11243_015900 [fungal sp.... 65 2e-08 >dbj|GAM83602.1| hypothetical protein ANO11243_015900 [fungal sp. No.11243] Length = 663 Score = 65.1 bits (157), Expect = 2e-08 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 4/68 (5%) Frame = -3 Query: 213 RHRTGSWRKRHNSNQPFGTKSWNESKDWRSPQQ--MTSNYTM-TPSREPSPI-NFMNQPR 46 R R+GSWRK + P+ + WN SKDWRSPQQ T++ T+ TP+R S I + ++ PR Sbjct: 575 RDRSGSWRKSSSGLPPYSNELWNVSKDWRSPQQPHYTASPTISTPTRPRSTISSLISPPR 634 Query: 45 RKSPRRNQ 22 RKSPRR+Q Sbjct: 635 RKSPRRSQ 642