BLASTX nr result
ID: Cinnamomum23_contig00055538
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00055538 (285 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007009031.1| Pleckstrin (PH) domain superfamily protein [... 106 5e-21 ref|XP_007218569.1| hypothetical protein PRUPE_ppa013025mg [Prun... 104 3e-20 ref|XP_008233738.1| PREDICTED: pleckstrin homology domain-contai... 102 8e-20 ref|XP_007215111.1| hypothetical protein PRUPE_ppa012881mg [Prun... 102 8e-20 ref|XP_007147536.1| hypothetical protein PHAVU_006G132900g [Phas... 102 1e-19 ref|XP_009350807.1| PREDICTED: pleckstrin homology domain-contai... 102 1e-19 ref|XP_004307627.1| PREDICTED: pleckstrin homology domain-contai... 102 1e-19 ref|XP_008392944.1| PREDICTED: pleckstrin homology domain-contai... 101 2e-19 ref|XP_004490979.1| PREDICTED: pleckstrin homology domain-contai... 101 2e-19 ref|XP_003519389.1| PREDICTED: pleckstrin homology domain-contai... 100 3e-19 ref|NP_001235232.1| uncharacterized protein LOC100527890 [Glycin... 100 6e-19 ref|XP_010262815.1| PREDICTED: pleckstrin homology domain-contai... 99 1e-18 ref|XP_010256586.1| PREDICTED: pleckstrin homology domain-contai... 97 3e-18 emb|CDP09177.1| unnamed protein product [Coffea canephora] 97 3e-18 ref|XP_002279631.1| PREDICTED: pleckstrin homology domain-contai... 97 5e-18 ref|XP_009603301.1| PREDICTED: pleckstrin homology domain-contai... 96 7e-18 ref|XP_002269271.1| PREDICTED: pleckstrin homology domain-contai... 96 1e-17 ref|XP_008368075.1| PREDICTED: pleckstrin homology domain-contai... 95 2e-17 ref|XP_003616621.1| Pleckstrin homology domain-containing protei... 95 2e-17 ref|XP_009605098.1| PREDICTED: pleckstrin homology domain-contai... 95 2e-17 >ref|XP_007009031.1| Pleckstrin (PH) domain superfamily protein [Theobroma cacao] gi|508725944|gb|EOY17841.1| Pleckstrin (PH) domain superfamily protein [Theobroma cacao] Length = 143 Score = 106 bits (265), Expect = 5e-21 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M SLWRAA LTEKPNDY GVEFWSNPER+GWLTKQGEYIKTWRRRWFVL+Q Sbjct: 1 MASLWRAATALTEKPNDYDGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQ 52 >ref|XP_007218569.1| hypothetical protein PRUPE_ppa013025mg [Prunus persica] gi|462415031|gb|EMJ19768.1| hypothetical protein PRUPE_ppa013025mg [Prunus persica] Length = 143 Score = 104 bits (259), Expect = 3e-20 Identities = 45/52 (86%), Positives = 47/52 (90%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M SLWRAA G TEKPNDY GVEFW NPER+GWLTKQGEYIKTWRRRWFVL+Q Sbjct: 1 MASLWRAATGQTEKPNDYDGVEFWLNPERTGWLTKQGEYIKTWRRRWFVLKQ 52 >ref|XP_008233738.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Prunus mume] Length = 143 Score = 102 bits (255), Expect = 8e-20 Identities = 44/52 (84%), Positives = 47/52 (90%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M SLWRAA G TEKPNDY GVEFW NPER+GWLTKQGEYIKTWRRRWFVL++ Sbjct: 1 MASLWRAATGRTEKPNDYDGVEFWLNPERTGWLTKQGEYIKTWRRRWFVLKR 52 >ref|XP_007215111.1| hypothetical protein PRUPE_ppa012881mg [Prunus persica] gi|462411261|gb|EMJ16310.1| hypothetical protein PRUPE_ppa012881mg [Prunus persica] Length = 151 Score = 102 bits (255), Expect = 8e-20 Identities = 44/52 (84%), Positives = 47/52 (90%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M SLWRAA G TEKPNDY GVEFW NPER+GWLTK+GEYIKTWRRRWFVL+Q Sbjct: 1 MASLWRAATGQTEKPNDYDGVEFWLNPERTGWLTKRGEYIKTWRRRWFVLKQ 52 >ref|XP_007147536.1| hypothetical protein PHAVU_006G132900g [Phaseolus vulgaris] gi|593694032|ref|XP_007147537.1| hypothetical protein PHAVU_006G132900g [Phaseolus vulgaris] gi|543176612|gb|AGV54329.1| pleckstrin homology domain-containing protein [Phaseolus vulgaris] gi|561020759|gb|ESW19530.1| hypothetical protein PHAVU_006G132900g [Phaseolus vulgaris] gi|561020760|gb|ESW19531.1| hypothetical protein PHAVU_006G132900g [Phaseolus vulgaris] Length = 146 Score = 102 bits (254), Expect = 1e-19 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M SLWRAA G++E P DY GVEFWSNPER+GWLTKQGEYIKTWRRRWFVL+Q Sbjct: 1 MASLWRAATGMSENPTDYDGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQ 52 >ref|XP_009350807.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Pyrus x bretschneideri] gi|694320315|ref|XP_009350815.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Pyrus x bretschneideri] Length = 143 Score = 102 bits (253), Expect = 1e-19 Identities = 44/52 (84%), Positives = 47/52 (90%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M SLWRAA G TE+ NDY GVEFWSNPER+GWLTKQGEYIKTWRRRWFVL+Q Sbjct: 1 MASLWRAAMGQTEQTNDYEGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQ 52 >ref|XP_004307627.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Fragaria vesca subsp. vesca] Length = 144 Score = 102 bits (253), Expect = 1e-19 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M SLWRAA GLT KP+D+ GVEFWSNPER+GWLTKQGEYIKTWRRRWFVL+Q Sbjct: 1 MASLWRAATGLTFKPDDHDGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQ 52 >ref|XP_008392944.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Malus domestica] Length = 143 Score = 101 bits (252), Expect = 2e-19 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M SLWRAA G T +PNDY G+EFWSNPER+GWLTKQGEYIKTWRRRWFVL+Q Sbjct: 1 MASLWRAAMGQTVQPNDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQ 52 >ref|XP_004490979.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Cicer arietinum] Length = 144 Score = 101 bits (252), Expect = 2e-19 Identities = 44/52 (84%), Positives = 46/52 (88%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M SLWRAA GLTE NDY GVEFWSNPER+GWL KQGEYIKTWRRRWFVL+Q Sbjct: 1 MASLWRAATGLTENQNDYDGVEFWSNPERTGWLMKQGEYIKTWRRRWFVLKQ 52 >ref|XP_003519389.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Glycine max] Length = 148 Score = 100 bits (250), Expect = 3e-19 Identities = 43/52 (82%), Positives = 46/52 (88%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M SLWRAA G+TE DY GVEFWSNPER+GWLTKQGEYIKTWRRRWFVL+Q Sbjct: 1 MASLWRAATGMTENATDYDGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQ 52 >ref|NP_001235232.1| uncharacterized protein LOC100527890 [Glycine max] gi|571505514|ref|XP_006595539.1| PREDICTED: uncharacterized protein LOC100527890 isoform X1 [Glycine max] gi|571505517|ref|XP_006595540.1| PREDICTED: uncharacterized protein LOC100527890 isoform X2 [Glycine max] gi|255633474|gb|ACU17095.1| unknown [Glycine max] Length = 146 Score = 99.8 bits (247), Expect = 6e-19 Identities = 42/52 (80%), Positives = 46/52 (88%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M SLWRAA G+T+ DY GVEFWSNPER+GWLTKQGEYIKTWRRRWFVL+Q Sbjct: 1 MASLWRAATGMTDNATDYDGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQ 52 >ref|XP_010262815.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Nelumbo nucifera] Length = 143 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/52 (80%), Positives = 47/52 (90%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M +LWRAA G T+K +DY GVEFWSNPER+GWLTKQGEYIKTWRRRWFVL+Q Sbjct: 1 MANLWRAAFGATQKTDDYDGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQ 52 >ref|XP_010256586.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Nelumbo nucifera] Length = 143 Score = 97.4 bits (241), Expect = 3e-18 Identities = 42/52 (80%), Positives = 46/52 (88%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M SLWRAA G + K +DY GVEFWSNPER+GWLTKQGEYIKTWRRRWFVL+Q Sbjct: 1 MASLWRAATGASLKADDYDGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQ 52 >emb|CDP09177.1| unnamed protein product [Coffea canephora] Length = 146 Score = 97.4 bits (241), Expect = 3e-18 Identities = 41/52 (78%), Positives = 44/52 (84%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M SLWR+ G P+DY GVEFWSNPERSGWLTKQGEYIKTWRRRWFVL+Q Sbjct: 1 MESLWRSVTGANPDPSDYAGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLKQ 52 >ref|XP_002279631.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Vitis vinifera] gi|147863745|emb|CAN83611.1| hypothetical protein VITISV_035612 [Vitis vinifera] Length = 143 Score = 96.7 bits (239), Expect = 5e-18 Identities = 41/52 (78%), Positives = 45/52 (86%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M LWRAAAGL KP DY GV+FWS PER+GWLTKQGEYIKTWRRRWFVL++ Sbjct: 1 MEGLWRAAAGLDPKPEDYEGVDFWSTPERAGWLTKQGEYIKTWRRRWFVLKR 52 >ref|XP_009603301.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Nicotiana tomentosiformis] Length = 143 Score = 96.3 bits (238), Expect = 7e-18 Identities = 41/52 (78%), Positives = 45/52 (86%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M SLWRAA G + +DY GVEFWSNPER+GWLTKQGEYIKTWRRRWFVL+Q Sbjct: 1 MASLWRAAMGAAQSNDDYDGVEFWSNPERAGWLTKQGEYIKTWRRRWFVLKQ 52 >ref|XP_002269271.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Vitis vinifera] Length = 143 Score = 95.5 bits (236), Expect = 1e-17 Identities = 41/52 (78%), Positives = 45/52 (86%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M SLWRAA G + +DY GVEFWSNPER+GWLTKQGEYIKTWRRRWFVL+Q Sbjct: 1 MWSLWRAATGTADDSDDYGGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQ 52 >ref|XP_008368075.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Malus domestica] Length = 141 Score = 95.1 bits (235), Expect = 2e-17 Identities = 43/52 (82%), Positives = 46/52 (88%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M SLWRAA G TE+ ND GVEFWSNPER+GWLTKQGEYIKTWRRRWFVL+Q Sbjct: 1 MASLWRAAMGQTEQTND--GVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQ 50 >ref|XP_003616621.1| Pleckstrin homology domain-containing protein [Medicago truncatula] gi|355517956|gb|AES99579.1| pleckstrin-like (PH) domain protein [Medicago truncatula] gi|388509562|gb|AFK42847.1| unknown [Medicago truncatula] Length = 144 Score = 95.1 bits (235), Expect = 2e-17 Identities = 41/50 (82%), Positives = 43/50 (86%) Frame = -2 Query: 152 SLWRAAAGLTEKPNDYVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 SLWR A G T P DY GVEFWSNPER+GWLTKQGEYIKTWRRRWFVL+Q Sbjct: 4 SLWRYATGSTTNPVDYSGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQ 53 >ref|XP_009605098.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Nicotiana tomentosiformis] gi|697192049|ref|XP_009605100.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Nicotiana tomentosiformis] Length = 144 Score = 94.7 bits (234), Expect = 2e-17 Identities = 43/53 (81%), Positives = 46/53 (86%), Gaps = 1/53 (1%) Frame = -2 Query: 158 MVSLWRAAAGLTEKPND-YVGVEFWSNPERSGWLTKQGEYIKTWRRRWFVLRQ 3 M SLWRAA G T + ND Y GVEFWSNPER+GWLTKQGEYIKTWRRRWFVL+Q Sbjct: 1 MASLWRAAMGSTTQSNDDYDGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQ 53