BLASTX nr result
ID: Cinnamomum23_contig00055511
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00055511 (345 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007794010.1| putative thiazole biosynthetic enzyme protei... 141 1e-31 emb|CEJ80029.1| Putative Thiamine thiazole synthase [Torrubiella... 139 6e-31 emb|CEJ80028.1| Putative Thiamine thiazole synthase [Torrubiella... 139 6e-31 ref|XP_006666857.1| thiazole biosynthetic enzyme [Cordyceps mili... 138 2e-30 gb|AGT99181.1| thiazole biosynthetic enzyme [Acremonium chrysoge... 137 3e-30 gb|KGQ06713.1| Thiamine thiazole synthase [Beauveria bassiana D1-5] 137 4e-30 ref|XP_008598283.1| mitochondrial thiazole biosynthetic enzyme [... 137 4e-30 gb|ABL63512.1| mitochondrial thiazole biosynthetic enzyme [Beauv... 137 4e-30 ref|XP_007289177.1| thiazole biosynthetic enzyme [Marssonina bru... 136 5e-30 ref|XP_008087498.1| FAD/NAD(P)-binding protein [Glarea lozoyensi... 135 8e-30 gb|EHL02685.1| putative Thiazole biosynthetic enzyme, mitochondr... 135 8e-30 ref|XP_003044703.1| predicted protein [Nectria haematococca mpVI... 135 1e-29 gb|ABG46357.1| mitochondrial thiazole biosynthetic enzyme [Trich... 135 1e-29 gb|EHK27008.1| hypothetical protein TRIVIDRAFT_215037 [Trichoder... 134 2e-29 ref|XP_007835960.1| Thiamine thiazole synthase [Pestalotiopsis f... 134 2e-29 gb|EWG49587.1| thiamine biosynthetic enzyme [Fusarium verticilli... 134 3e-29 gb|EWG49586.1| thiamine biosynthetic enzyme [Fusarium verticilli... 134 3e-29 sp|P23618.2|THI4_FUSOX RecName: Full=Thiamine thiazole synthase;... 134 3e-29 gb|KLO87023.1| putative CyPBP37 protein (protein binding to CyP4... 134 3e-29 gb|KIL95952.1| hypothetical protein FAVG1_00690 [Fusarium avenac... 134 3e-29 >ref|XP_007794010.1| putative thiazole biosynthetic enzyme protein [Eutypa lata UCREL1] gi|471566675|gb|EMR66906.1| putative thiazole biosynthetic enzyme protein [Eutypa lata UCREL1] Length = 326 Score = 141 bits (356), Expect = 1e-31 Identities = 68/75 (90%), Positives = 74/75 (98%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 E+LGGMRGLDMN AEDAIVKGTRE+VPGLICGGMELSE+DGANRMGPTFGAMALSGVKAA Sbjct: 251 ERLGGMRGLDMNRAEDAIVKGTREVVPGLICGGMELSEIDGANRMGPTFGAMALSGVKAA 310 Query: 164 EEALSVFEQRKKENA 120 EEAL+VFE+RKK+NA Sbjct: 311 EEALAVFEERKKQNA 325 >emb|CEJ80029.1| Putative Thiamine thiazole synthase [Torrubiella hemipterigena] Length = 329 Score = 139 bits (351), Expect = 6e-31 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMNTAEDAIVKGTREIVPGLI GGMELSEVDGANRMGPTFGAM LSGVKAA Sbjct: 254 EKLGGMRGLDMNTAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMVLSGVKAA 313 Query: 164 EEALSVFEQRKKEN 123 EEAL VF+QRKKEN Sbjct: 314 EEALKVFDQRKKEN 327 >emb|CEJ80028.1| Putative Thiamine thiazole synthase [Torrubiella hemipterigena] Length = 381 Score = 139 bits (351), Expect = 6e-31 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMNTAEDAIVKGTREIVPGLI GGMELSEVDGANRMGPTFGAM LSGVKAA Sbjct: 306 EKLGGMRGLDMNTAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMVLSGVKAA 365 Query: 164 EEALSVFEQRKKEN 123 EEAL VF+QRKKEN Sbjct: 366 EEALKVFDQRKKEN 379 >ref|XP_006666857.1| thiazole biosynthetic enzyme [Cordyceps militaris CM01] gi|346327384|gb|EGX96980.1| thiazole biosynthetic enzyme [Cordyceps militaris CM01] Length = 330 Score = 138 bits (347), Expect = 2e-30 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMNTAEDAIVKGTREIVPGLI GGMELSEVDGANRMGPTFGAMALSGVKAA Sbjct: 255 EKLGGMRGLDMNTAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAA 314 Query: 164 EEALSVFEQRKKEN 123 EEAL VF+ RKKEN Sbjct: 315 EEALKVFDIRKKEN 328 >gb|AGT99181.1| thiazole biosynthetic enzyme [Acremonium chrysogenum] gi|672792538|gb|KFH43147.1| Thiamine thiazole synthase-like protein [Acremonium chrysogenum ATCC 11550] Length = 328 Score = 137 bits (345), Expect = 3e-30 Identities = 70/75 (93%), Positives = 70/75 (93%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMNTAEDAIVK TREIVPGLI GGMELSEVDGANRMGPTFGAM LSGVKAA Sbjct: 253 EKLGGMRGLDMNTAEDAIVKNTREIVPGLIVGGMELSEVDGANRMGPTFGAMVLSGVKAA 312 Query: 164 EEALSVFEQRKKENA 120 EEAL VFE RKKENA Sbjct: 313 EEALRVFETRKKENA 327 >gb|KGQ06713.1| Thiamine thiazole synthase [Beauveria bassiana D1-5] Length = 330 Score = 137 bits (344), Expect = 4e-30 Identities = 69/74 (93%), Positives = 71/74 (95%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMNTAEDAIVKGTREIVPGLI GGMELSEVDGANRMGPTFGAMALSG+KAA Sbjct: 255 EKLGGMRGLDMNTAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAA 314 Query: 164 EEALSVFEQRKKEN 123 EEAL VF+ RKKEN Sbjct: 315 EEALKVFDIRKKEN 328 >ref|XP_008598283.1| mitochondrial thiazole biosynthetic enzyme [Beauveria bassiana ARSEF 2860] gi|400598276|gb|EJP65993.1| mitochondrial thiazole biosynthetic enzyme [Beauveria bassiana ARSEF 2860] Length = 330 Score = 137 bits (344), Expect = 4e-30 Identities = 69/74 (93%), Positives = 71/74 (95%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMNTAEDAIVKGTREIVPGLI GGMELSEVDGANRMGPTFGAMALSG+KAA Sbjct: 255 EKLGGMRGLDMNTAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAA 314 Query: 164 EEALSVFEQRKKEN 123 EEAL VF+ RKKEN Sbjct: 315 EEALKVFDIRKKEN 328 >gb|ABL63512.1| mitochondrial thiazole biosynthetic enzyme [Beauveria bassiana] Length = 330 Score = 137 bits (344), Expect = 4e-30 Identities = 69/74 (93%), Positives = 71/74 (95%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMNTAEDAIVKGTREIVPGLI GGMELSEVDGANRMGPTFGAMALSG+KAA Sbjct: 255 EKLGGMRGLDMNTAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAA 314 Query: 164 EEALSVFEQRKKEN 123 EEAL VF+ RKKEN Sbjct: 315 EEALKVFDIRKKEN 328 >ref|XP_007289177.1| thiazole biosynthetic enzyme [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406867568|gb|EKD20606.1| thiazole biosynthetic enzyme [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 327 Score = 136 bits (343), Expect = 5e-30 Identities = 69/76 (90%), Positives = 72/76 (94%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMNTAEDAIVK TREIVPGLI GGMELSEVDGANRMGPTFGAMALSGVKAA Sbjct: 252 EKLGGMRGLDMNTAEDAIVKRTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAA 311 Query: 164 EEALSVFEQRKKENAH 117 EEAL VFE+RK +NA+ Sbjct: 312 EEALKVFEERKLQNAY 327 >ref|XP_008087498.1| FAD/NAD(P)-binding protein [Glarea lozoyensis ATCC 20868] gi|512197343|gb|EPE26179.1| FAD/NAD(P)-binding protein [Glarea lozoyensis ATCC 20868] Length = 328 Score = 135 bits (341), Expect = 8e-30 Identities = 66/76 (86%), Positives = 72/76 (94%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMNTAEDAIVK TRE+VPGL+ GGMELSEVDGANRMGPTFGAMALSGVKAA Sbjct: 253 EKLGGMRGLDMNTAEDAIVKRTREVVPGLVVGGMELSEVDGANRMGPTFGAMALSGVKAA 312 Query: 164 EEALSVFEQRKKENAH 117 EE L VF++RKK+NA+ Sbjct: 313 EEVLKVFDERKKQNAY 328 >gb|EHL02685.1| putative Thiazole biosynthetic enzyme, mitochondrial [Glarea lozoyensis 74030] Length = 322 Score = 135 bits (341), Expect = 8e-30 Identities = 66/76 (86%), Positives = 72/76 (94%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMNTAEDAIVK TRE+VPGL+ GGMELSEVDGANRMGPTFGAMALSGVKAA Sbjct: 247 EKLGGMRGLDMNTAEDAIVKRTREVVPGLVVGGMELSEVDGANRMGPTFGAMALSGVKAA 306 Query: 164 EEALSVFEQRKKENAH 117 EE L VF++RKK+NA+ Sbjct: 307 EEVLKVFDERKKQNAY 322 >ref|XP_003044703.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|378524364|sp|C7Z8P6.1|THI4_NECH7 RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole biosynthetic enzyme gi|256725628|gb|EEU38990.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 322 Score = 135 bits (339), Expect = 1e-29 Identities = 67/75 (89%), Positives = 71/75 (94%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMN AEDAIVKGTREIVPGLI GGMELSEVDGANRMGPTFGAMALSG+KAA Sbjct: 247 EKLGGMRGLDMNVAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAA 306 Query: 164 EEALSVFEQRKKENA 120 EEAL +F+ RKK+NA Sbjct: 307 EEALKIFDIRKKQNA 321 >gb|ABG46357.1| mitochondrial thiazole biosynthetic enzyme [Trichoderma harzianum] gi|818167071|gb|KKP06454.1| hypothetical protein THAR02_01412 [Trichoderma harzianum] Length = 322 Score = 135 bits (339), Expect = 1e-29 Identities = 67/75 (89%), Positives = 70/75 (93%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMN AEDAIVK TRE+VPGLI GGMELSE+DGANRMGPTFGAMALSGVKAA Sbjct: 247 EKLGGMRGLDMNRAEDAIVKNTREVVPGLIVGGMELSEIDGANRMGPTFGAMALSGVKAA 306 Query: 164 EEALSVFEQRKKENA 120 EEAL VFE R+KENA Sbjct: 307 EEALKVFETRRKENA 321 >gb|EHK27008.1| hypothetical protein TRIVIDRAFT_215037 [Trichoderma virens Gv29-8] Length = 322 Score = 134 bits (338), Expect = 2e-29 Identities = 66/75 (88%), Positives = 70/75 (93%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMN AEDAIVK TRE+VPGLI GGMELSE+DGANRMGPTFGAMALSGVKAA Sbjct: 247 EKLGGMRGLDMNRAEDAIVKNTREVVPGLIVGGMELSEIDGANRMGPTFGAMALSGVKAA 306 Query: 164 EEALSVFEQRKKENA 120 EEAL +FE R+KENA Sbjct: 307 EEALKIFETRRKENA 321 >ref|XP_007835960.1| Thiamine thiazole synthase [Pestalotiopsis fici W106-1] gi|573059537|gb|ETS79335.1| Thiamine thiazole synthase [Pestalotiopsis fici W106-1] Length = 326 Score = 134 bits (337), Expect = 2e-29 Identities = 67/75 (89%), Positives = 72/75 (96%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDM TAEDAIVKGTREIVPGLI GGMELSEVDGANRMGPTFGAMALSGVKAA Sbjct: 251 EKLGGMRGLDMQTAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAA 310 Query: 164 EEALSVFEQRKKENA 120 EEAL+VF+ R+K+N+ Sbjct: 311 EEALAVFDLRQKQNS 325 >gb|EWG49587.1| thiamine biosynthetic enzyme [Fusarium verticillioides 7600] gi|584140254|gb|EWG49588.1| thiamine biosynthetic enzyme [Fusarium verticillioides 7600] Length = 320 Score = 134 bits (336), Expect = 3e-29 Identities = 66/74 (89%), Positives = 70/74 (94%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMN AEDAIVKGTREIVPGLI GGMELSEVDGANRMGPTFGAMALSG+KAA Sbjct: 245 EKLGGMRGLDMNLAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAA 304 Query: 164 EEALSVFEQRKKEN 123 EEAL +F+ RKK+N Sbjct: 305 EEALKIFDTRKKQN 318 >gb|EWG49586.1| thiamine biosynthetic enzyme [Fusarium verticillioides 7600] Length = 427 Score = 134 bits (336), Expect = 3e-29 Identities = 66/74 (89%), Positives = 70/74 (94%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMN AEDAIVKGTREIVPGLI GGMELSEVDGANRMGPTFGAMALSG+KAA Sbjct: 352 EKLGGMRGLDMNLAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAA 411 Query: 164 EEALSVFEQRKKEN 123 EEAL +F+ RKK+N Sbjct: 412 EEALKIFDTRKKQN 425 >sp|P23618.2|THI4_FUSOX RecName: Full=Thiamine thiazole synthase; AltName: Full=Stress-inducible protein sti35; AltName: Full=Thiazole biosynthetic enzyme gi|544604719|sp|J9N5G7.1|THI4_FUSO4 RecName: Full=Thiamine thiazole synthase; AltName: Full=Stress-inducible protein sti35; AltName: Full=Thiazole biosynthetic enzyme gi|168164|gb|AAA33341.1| STI35 protein [Fusarium oxysporum] gi|6045153|dbj|BAA85305.1| sti35 [Fusarium oxysporum] gi|342887448|gb|EGU86946.1| hypothetical protein FOXB_02553 [Fusarium oxysporum Fo5176] gi|477513691|gb|ENH66155.1| Thiazole biosynthetic enzyme, mitochondrial [Fusarium oxysporum f. sp. cubense race 1] gi|517317785|emb|CCT68966.1| probable CyPBP37 protein (protein binding to CyP41) [Fusarium fujikuroi IMI 58289] gi|587669186|gb|EWY91527.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a] gi|587669187|gb|EWY91528.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a] gi|587669188|gb|EWY91529.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a] gi|587669189|gb|EWY91530.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a] gi|587669190|gb|EWY91531.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a] gi|587669191|gb|EWY91532.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a] gi|587669192|gb|EWY91533.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a] gi|587691586|gb|EWZ38191.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47] gi|587691587|gb|EWZ38192.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47] gi|587691588|gb|EWZ38193.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47] gi|587691589|gb|EWZ38194.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47] gi|587691590|gb|EWZ38195.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47] gi|587691591|gb|EWZ38196.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47] gi|587691592|gb|EWZ38197.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47] gi|587691593|gb|EWZ38198.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47] gi|587711424|gb|EWZ82761.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici MN25] gi|587711425|gb|EWZ82762.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici MN25] gi|587711426|gb|EWZ82763.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici MN25] gi|587711427|gb|EWZ82764.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici MN25] gi|587711428|gb|EWZ82765.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici MN25] gi|587711429|gb|EWZ82766.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici MN25] gi|587711430|gb|EWZ82767.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici MN25] gi|587711431|gb|EWZ82768.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici MN25] gi|587748067|gb|EXA45783.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. pisi HDV247] gi|587748068|gb|EXA45784.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. pisi HDV247] gi|587748069|gb|EXA45785.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. pisi HDV247] gi|587748070|gb|EXA45786.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. pisi HDV247] gi|587748071|gb|EXA45787.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. pisi HDV247] gi|590038408|gb|EXK40266.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 26406] gi|590038409|gb|EXK40267.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 26406] gi|590038410|gb|EXK40268.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 26406] gi|590038411|gb|EXK40269.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 26406] gi|590038412|gb|EXK40270.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 26406] gi|590038413|gb|EXK40271.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 26406] gi|590064770|gb|EXK92294.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. raphani 54005] gi|590064771|gb|EXK92295.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. raphani 54005] gi|590064772|gb|EXK92296.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. raphani 54005] gi|590064773|gb|EXK92297.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. raphani 54005] gi|590064774|gb|EXK92298.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. raphani 54005] gi|591422521|gb|EXL57658.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591422522|gb|EXL57659.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591422523|gb|EXL57660.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591422524|gb|EXL57661.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591422525|gb|EXL57662.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591422526|gb|EXL57663.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591422527|gb|EXL57664.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591443597|gb|EXL76154.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591443598|gb|EXL76155.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591443599|gb|EXL76156.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591443600|gb|EXL76157.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591465704|gb|EXL97128.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591465705|gb|EXL97129.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591465706|gb|EXL97130.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591465707|gb|EXL97131.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591465708|gb|EXL97132.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591465709|gb|EXL97133.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591465710|gb|EXL97134.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591465711|gb|EXL97135.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591493987|gb|EXM23548.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. vasinfectum 25433] gi|591493988|gb|EXM23549.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. vasinfectum 25433] gi|591493989|gb|EXM23550.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. vasinfectum 25433] gi|591493990|gb|EXM23551.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. vasinfectum 25433] gi|591493991|gb|EXM23552.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. vasinfectum 25433] gi|829143650|gb|KLP14912.1| putative CyPBP37 protein (protein binding to CyP41) [Fusarium fujikuroi] Length = 320 Score = 134 bits (336), Expect = 3e-29 Identities = 66/74 (89%), Positives = 70/74 (94%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMN AEDAIVKGTREIVPGLI GGMELSEVDGANRMGPTFGAMALSG+KAA Sbjct: 245 EKLGGMRGLDMNLAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAA 304 Query: 164 EEALSVFEQRKKEN 123 EEAL +F+ RKK+N Sbjct: 305 EEALKIFDTRKKQN 318 >gb|KLO87023.1| putative CyPBP37 protein (protein binding to CyP41) [Fusarium fujikuroi] gi|829138900|gb|KLP11920.1| putative CyPBP37 protein (protein binding to CyP41) [Fusarium fujikuroi] Length = 320 Score = 134 bits (336), Expect = 3e-29 Identities = 66/74 (89%), Positives = 70/74 (94%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMN AEDAIVKGTREIVPGLI GGMELSEVDGANRMGPTFGAMALSG+KAA Sbjct: 245 EKLGGMRGLDMNLAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAA 304 Query: 164 EEALSVFEQRKKEN 123 EEAL +F+ RKK+N Sbjct: 305 EEALKIFDTRKKQN 318 >gb|KIL95952.1| hypothetical protein FAVG1_00690 [Fusarium avenaceum] Length = 322 Score = 134 bits (336), Expect = 3e-29 Identities = 66/74 (89%), Positives = 70/74 (94%) Frame = -2 Query: 344 EKLGGMRGLDMNTAEDAIVKGTREIVPGLICGGMELSEVDGANRMGPTFGAMALSGVKAA 165 EKLGGMRGLDMN AEDAIVKGTREIVPGLI GGMELSEVDGANRMGPTFGAMALSG+KAA Sbjct: 247 EKLGGMRGLDMNLAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAA 306 Query: 164 EEALSVFEQRKKEN 123 EEAL +F+ RKK+N Sbjct: 307 EEALKIFDTRKKQN 320