BLASTX nr result
ID: Cinnamomum23_contig00055410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00055410 (444 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY17302.1| putative rna polymerase i and iii transcription f... 75 2e-11 gb|KIW08403.1| TATA-box-binding protein [Verruconis gallopava] g... 75 2e-11 dbj|GAM87959.1| hypothetical protein ANO11243_059880 [fungal sp.... 75 2e-11 ref|XP_007588693.1| putative tata-box-binding protein [Neofusico... 75 2e-11 ref|XP_008020514.1| hypothetical protein SETTUDRAFT_87224 [Setos... 75 2e-11 ref|XP_007687649.1| hypothetical protein COCMIDRAFT_94399 [Bipol... 75 2e-11 gb|EKG20002.1| TATA-box binding protein [Macrophomina phaseolina... 75 2e-11 ref|XP_003837823.1| similar to transcription initiation factor T... 75 2e-11 ref|XP_001932751.1| TATA-box-binding protein [Pyrenophora tritic... 75 2e-11 ref|XP_001796519.1| hypothetical protein SNOG_06135 [Phaeosphaer... 75 2e-11 emb|CRG92487.1| TATA-box-binding protein [Talaromyces islandicus] 74 4e-11 gb|KJX96384.1| transcription initiation factor TFIID/TATA-box-bi... 74 4e-11 ref|XP_002479956.1| RNA polymerase I and III transcription facto... 74 4e-11 ref|XP_002143637.1| RNA polymerase I and III transcription facto... 74 4e-11 gb|EMF11507.1| transcription initiation factor TFIID, TATA bindi... 74 4e-11 ref|XP_007921677.1| hypothetical protein MYCFIDRAFT_209898 [Pseu... 74 4e-11 gb|EME41317.1| TATA-box binding-like protein [Dothistroma septos... 74 4e-11 ref|XP_007679924.1| hypothetical protein BAUCODRAFT_76816 [Baudo... 74 4e-11 ref|XP_003854726.1| transcription factor TFIID complex [Zymosept... 74 4e-11 emb|CDM28778.1| TATA-box-binding protein [Penicillium roqueforti... 74 5e-11 >gb|KKY17302.1| putative rna polymerase i and iii transcription factor complex component [Diplodia seriata] Length = 249 Score = 75.1 bits (183), Expect = 2e-11 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS Sbjct: 212 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 249 >gb|KIW08403.1| TATA-box-binding protein [Verruconis gallopava] gi|759231432|gb|KIW08404.1| TATA-box-binding protein, variant [Verruconis gallopava] Length = 252 Score = 75.1 bits (183), Expect = 2e-11 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS Sbjct: 215 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 252 >dbj|GAM87959.1| hypothetical protein ANO11243_059880 [fungal sp. No.11243] Length = 257 Score = 75.1 bits (183), Expect = 2e-11 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS Sbjct: 220 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 257 >ref|XP_007588693.1| putative tata-box-binding protein [Neofusicoccum parvum UCRNP2] gi|485916518|gb|EOD43847.1| putative tata-box-binding protein [Neofusicoccum parvum UCRNP2] Length = 250 Score = 75.1 bits (183), Expect = 2e-11 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS Sbjct: 213 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 250 >ref|XP_008020514.1| hypothetical protein SETTUDRAFT_87224 [Setosphaeria turcica Et28A] gi|482815275|gb|EOA91950.1| hypothetical protein SETTUDRAFT_87224 [Setosphaeria turcica Et28A] Length = 249 Score = 75.1 bits (183), Expect = 2e-11 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS Sbjct: 212 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 249 >ref|XP_007687649.1| hypothetical protein COCMIDRAFT_94399 [Bipolaris oryzae ATCC 44560] gi|628058952|ref|XP_007695742.1| hypothetical protein COCSADRAFT_156488 [Bipolaris sorokiniana ND90Pr] gi|628189258|ref|XP_007708201.1| hypothetical protein COCCADRAFT_85362 [Bipolaris zeicola 26-R-13] gi|451854730|gb|EMD68022.1| hypothetical protein COCSADRAFT_156488 [Bipolaris sorokiniana ND90Pr] gi|452000886|gb|EMD93346.1| hypothetical protein COCHEDRAFT_1153946 [Bipolaris maydis C5] gi|477590131|gb|ENI07206.1| hypothetical protein COCC4DRAFT_38809 [Bipolaris maydis ATCC 48331] gi|576923425|gb|EUC37543.1| hypothetical protein COCCADRAFT_85362 [Bipolaris zeicola 26-R-13] gi|576932336|gb|EUC45880.1| hypothetical protein COCMIDRAFT_94399 [Bipolaris oryzae ATCC 44560] gi|578493995|gb|EUN31384.1| hypothetical protein COCVIDRAFT_87975 [Bipolaris victoriae FI3] Length = 249 Score = 75.1 bits (183), Expect = 2e-11 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS Sbjct: 212 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 249 >gb|EKG20002.1| TATA-box binding protein [Macrophomina phaseolina MS6] Length = 250 Score = 75.1 bits (183), Expect = 2e-11 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS Sbjct: 213 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 250 >ref|XP_003837823.1| similar to transcription initiation factor TFIID [Leptosphaeria maculans JN3] gi|312214387|emb|CBX94379.1| similar to transcription initiation factor TFIID [Leptosphaeria maculans JN3] Length = 246 Score = 75.1 bits (183), Expect = 2e-11 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS Sbjct: 209 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 246 >ref|XP_001932751.1| TATA-box-binding protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330941403|ref|XP_003306059.1| hypothetical protein PTT_19076 [Pyrenophora teres f. teres 0-1] gi|187978315|gb|EDU44941.1| TATA-box-binding protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311316652|gb|EFQ85856.1| hypothetical protein PTT_19076 [Pyrenophora teres f. teres 0-1] Length = 249 Score = 75.1 bits (183), Expect = 2e-11 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS Sbjct: 212 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 249 >ref|XP_001796519.1| hypothetical protein SNOG_06135 [Phaeosphaeria nodorum SN15] gi|160706937|gb|EAT85966.2| hypothetical protein SNOG_06135 [Phaeosphaeria nodorum SN15] Length = 247 Score = 75.1 bits (183), Expect = 2e-11 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS Sbjct: 210 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 247 >emb|CRG92487.1| TATA-box-binding protein [Talaromyces islandicus] Length = 255 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK+ Sbjct: 218 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKT 255 >gb|KJX96384.1| transcription initiation factor TFIID/TATA-box-binding protein [Zymoseptoria brevis] Length = 261 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK+ Sbjct: 224 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKT 261 >ref|XP_002479956.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces stipitatus ATCC 10500] gi|242782222|ref|XP_002479957.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces stipitatus ATCC 10500] gi|218720103|gb|EED19522.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces stipitatus ATCC 10500] gi|218720104|gb|EED19523.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces stipitatus ATCC 10500] Length = 255 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK+ Sbjct: 218 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKT 255 >ref|XP_002143637.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|212526962|ref|XP_002143638.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|212526964|ref|XP_002143639.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|62956011|gb|AAY23352.1| TATA-binding protein [Talaromyces marneffei] gi|62956013|gb|AAY23353.1| TATA-binding protein [Talaromyces marneffei] gi|210073035|gb|EEA27122.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|210073036|gb|EEA27123.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|210073037|gb|EEA27124.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|679997989|gb|KFX50234.1| TATA-box-binding protein [Talaromyces marneffei PM1] gi|679997990|gb|KFX50235.1| TATA-box-binding protein [Talaromyces marneffei PM1] gi|679997991|gb|KFX50236.1| TATA-box-binding protein [Talaromyces marneffei PM1] gi|748554959|dbj|GAM39636.1| hypothetical protein TCE0_034f11345 [Talaromyces cellulolyticus] Length = 255 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK+ Sbjct: 218 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKT 255 >gb|EMF11507.1| transcription initiation factor TFIID, TATA binding protein [Sphaerulina musiva SO2202] Length = 258 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK+ Sbjct: 221 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKT 258 >ref|XP_007921677.1| hypothetical protein MYCFIDRAFT_209898 [Pseudocercospora fijiensis CIRAD86] gi|452989027|gb|EME88782.1| hypothetical protein MYCFIDRAFT_209898 [Pseudocercospora fijiensis CIRAD86] Length = 260 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK+ Sbjct: 223 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKT 260 >gb|EME41317.1| TATA-box binding-like protein [Dothistroma septosporum NZE10] Length = 254 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK+ Sbjct: 217 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKT 254 >ref|XP_007679924.1| hypothetical protein BAUCODRAFT_76816 [Baudoinia compniacensis UAMH 10762] gi|449296869|gb|EMC92888.1| hypothetical protein BAUCODRAFT_76816 [Baudoinia compniacensis UAMH 10762] Length = 240 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK+ Sbjct: 203 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKT 240 >ref|XP_003854726.1| transcription factor TFIID complex [Zymoseptoria tritici IPO323] gi|339474610|gb|EGP89702.1| transcription factor TFIID complex [Zymoseptoria tritici IPO323] Length = 261 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 331 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK+ Sbjct: 224 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKT 261 >emb|CDM28778.1| TATA-box-binding protein [Penicillium roqueforti FM164] Length = 264 Score = 73.6 bits (179), Expect = 5e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 444 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK 334 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK Sbjct: 227 VLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK 263