BLASTX nr result
ID: Cinnamomum23_contig00055290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00055290 (343 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006354868.1| PREDICTED: heat stress transcription factor ... 151 1e-34 ref|XP_004238144.1| PREDICTED: heat stress transcription factor ... 151 1e-34 ref|XP_010112180.1| Heat stress transcription factor B-4 [Morus ... 150 3e-34 emb|CDP01323.1| unnamed protein product [Coffea canephora] 150 3e-34 ref|XP_012447183.1| PREDICTED: heat stress transcription factor ... 149 7e-34 ref|XP_011074417.1| PREDICTED: LOW QUALITY PROTEIN: heat stress ... 149 7e-34 ref|XP_011017186.1| PREDICTED: heat stress transcription factor ... 149 7e-34 ref|XP_011029683.1| PREDICTED: heat stress transcription factor ... 149 7e-34 ref|XP_009800135.1| PREDICTED: heat stress transcription factor ... 149 7e-34 ref|XP_012068333.1| PREDICTED: heat stress transcription factor ... 149 7e-34 emb|CBI19505.3| unnamed protein product [Vitis vinifera] 149 7e-34 ref|XP_002301176.2| hypothetical protein POPTR_0002s12640g [Popu... 149 7e-34 ref|XP_006374916.1| hypothetical protein POPTR_0014s02700g [Popu... 149 7e-34 ref|XP_004501560.1| PREDICTED: heat stress transcription factor ... 149 7e-34 ref|XP_003603058.1| Heat stress transcription factor B-4 [Medica... 149 7e-34 ref|XP_006374917.1| heat shock transcription factor HSF31 family... 149 7e-34 ref|XP_002284836.1| PREDICTED: heat stress transcription factor ... 149 7e-34 ref|XP_006473306.1| PREDICTED: heat stress transcription factor ... 149 9e-34 ref|XP_006434743.1| hypothetical protein CICLE_v10001482mg [Citr... 149 9e-34 ref|XP_008220242.1| PREDICTED: heat stress transcription factor ... 148 1e-33 >ref|XP_006354868.1| PREDICTED: heat stress transcription factor B-4-like [Solanum tuberosum] Length = 372 Score = 151 bits (382), Expect = 1e-34 Identities = 70/70 (100%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >ref|XP_004238144.1| PREDICTED: heat stress transcription factor B-4 [Solanum lycopersicum] Length = 360 Score = 151 bits (382), Expect = 1e-34 Identities = 70/70 (100%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >ref|XP_010112180.1| Heat stress transcription factor B-4 [Morus notabilis] gi|587946511|gb|EXC32846.1| Heat stress transcription factor B-4 [Morus notabilis] Length = 394 Score = 150 bits (379), Expect = 3e-34 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDD+TFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDTTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >emb|CDP01323.1| unnamed protein product [Coffea canephora] Length = 299 Score = 150 bits (379), Expect = 3e-34 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDD+TFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDTTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >ref|XP_012447183.1| PREDICTED: heat stress transcription factor B-4-like [Gossypium raimondii] gi|763791520|gb|KJB58516.1| hypothetical protein B456_009G213100 [Gossypium raimondii] Length = 360 Score = 149 bits (376), Expect = 7e-34 Identities = 68/70 (97%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDD+TFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >ref|XP_011074417.1| PREDICTED: LOW QUALITY PROTEIN: heat stress transcription factor B-4-like [Sesamum indicum] Length = 371 Score = 149 bits (376), Expect = 7e-34 Identities = 68/70 (97%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDD+TFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >ref|XP_011017186.1| PREDICTED: heat stress transcription factor B-4-like [Populus euphratica] Length = 364 Score = 149 bits (376), Expect = 7e-34 Identities = 68/70 (97%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDD+TFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >ref|XP_011029683.1| PREDICTED: heat stress transcription factor B-4-like [Populus euphratica] Length = 368 Score = 149 bits (376), Expect = 7e-34 Identities = 68/70 (97%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDD+TFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >ref|XP_009800135.1| PREDICTED: heat stress transcription factor B-4 [Nicotiana sylvestris] Length = 352 Score = 149 bits (376), Expect = 7e-34 Identities = 67/70 (95%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MA+MLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDDSTF+VWRPPEFA Sbjct: 1 MAMMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDSTFIVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >ref|XP_012068333.1| PREDICTED: heat stress transcription factor B-4 [Jatropha curcas] gi|643735049|gb|KDP41719.1| hypothetical protein JCGZ_16126 [Jatropha curcas] Length = 361 Score = 149 bits (376), Expect = 7e-34 Identities = 68/70 (97%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDD+TFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >emb|CBI19505.3| unnamed protein product [Vitis vinifera] Length = 281 Score = 149 bits (376), Expect = 7e-34 Identities = 68/70 (97%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDD+TFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >ref|XP_002301176.2| hypothetical protein POPTR_0002s12640g [Populus trichocarpa] gi|550344872|gb|EEE80449.2| hypothetical protein POPTR_0002s12640g [Populus trichocarpa] Length = 364 Score = 149 bits (376), Expect = 7e-34 Identities = 68/70 (97%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDD+TFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >ref|XP_006374916.1| hypothetical protein POPTR_0014s02700g [Populus trichocarpa] gi|550323227|gb|ERP52713.1| hypothetical protein POPTR_0014s02700g [Populus trichocarpa] Length = 349 Score = 149 bits (376), Expect = 7e-34 Identities = 68/70 (97%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDD+TFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >ref|XP_004501560.1| PREDICTED: heat stress transcription factor B-4 [Cicer arietinum] Length = 375 Score = 149 bits (376), Expect = 7e-34 Identities = 68/70 (97%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDDSTFVVWRPPEFA Sbjct: 1 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPNTDHIVSWGEDDSTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >ref|XP_003603058.1| Heat stress transcription factor B-4 [Medicago truncatula] gi|355492106|gb|AES73309.1| heat shock transcription factor [Medicago truncatula] Length = 373 Score = 149 bits (376), Expect = 7e-34 Identities = 68/70 (97%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDDSTFVVWRPPEFA Sbjct: 1 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDSTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >ref|XP_006374917.1| heat shock transcription factor HSF31 family protein [Populus trichocarpa] gi|118488115|gb|ABK95877.1| unknown [Populus trichocarpa] gi|550323228|gb|ERP52714.1| heat shock transcription factor HSF31 family protein [Populus trichocarpa] Length = 368 Score = 149 bits (376), Expect = 7e-34 Identities = 68/70 (97%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDD+TFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >ref|XP_002284836.1| PREDICTED: heat stress transcription factor B-4 [Vitis vinifera] gi|147768919|emb|CAN66983.1| hypothetical protein VITISV_004457 [Vitis vinifera] Length = 363 Score = 149 bits (376), Expect = 7e-34 Identities = 68/70 (97%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDD+TFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >ref|XP_006473306.1| PREDICTED: heat stress transcription factor B-4-like [Citrus sinensis] gi|641865449|gb|KDO84134.1| hypothetical protein CISIN_1g016692mg [Citrus sinensis] Length = 384 Score = 149 bits (375), Expect = 9e-34 Identities = 67/70 (95%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDH+VSWGEDD+TFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHVVSWGEDDTTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >ref|XP_006434743.1| hypothetical protein CICLE_v10001482mg [Citrus clementina] gi|557536865|gb|ESR47983.1| hypothetical protein CICLE_v10001482mg [Citrus clementina] Length = 383 Score = 149 bits (375), Expect = 9e-34 Identities = 67/70 (95%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDH+VSWGEDD+TFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHVVSWGEDDTTFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70 >ref|XP_008220242.1| PREDICTED: heat stress transcription factor B-4 [Prunus mume] Length = 389 Score = 148 bits (374), Expect = 1e-33 Identities = 67/70 (95%), Positives = 70/70 (100%) Frame = -3 Query: 212 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA 33 MALM+DNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDD+TFVVWRPPEFA Sbjct: 1 MALMMDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDATFVVWRPPEFA 60 Query: 32 RDLLPNYFKH 3 RDLLPNYFKH Sbjct: 61 RDLLPNYFKH 70