BLASTX nr result
ID: Cinnamomum23_contig00055286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00055286 (439 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007782033.1| hypothetical protein W97_05962 [Coniosporium... 59 1e-06 >ref|XP_007782033.1| hypothetical protein W97_05962 [Coniosporium apollinis CBS 100218] gi|494830150|gb|EON66716.1| hypothetical protein W97_05962 [Coniosporium apollinis CBS 100218] Length = 832 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/54 (50%), Positives = 33/54 (61%) Frame = -3 Query: 248 PVGRRASWQPGRKTVQXXXXXXXXXXXXXXXDAIVWNIPLSPRPPESRSVSQSP 87 P+GRR SWQPGRKTV+ DAI+WN+P+SPRPP RS +P Sbjct: 268 PLGRRQSWQPGRKTVKELEDEYHDSDEEVPEDAIMWNVPVSPRPPHERSTPPTP 321