BLASTX nr result
ID: Cinnamomum23_contig00055227
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00055227 (296 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007729900.1| hypothetical protein A1O3_01566, partial [Ca... 57 6e-06 >ref|XP_007729900.1| hypothetical protein A1O3_01566, partial [Capronia epimyces CBS 606.96] gi|590017810|gb|EXJ93010.1| hypothetical protein A1O3_01566, partial [Capronia epimyces CBS 606.96] Length = 72 Score = 56.6 bits (135), Expect = 6e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -2 Query: 295 DTGSDFIWNQWNKGRQWKDIKQKYMDSGDGEDE 197 D +D +W+ WNKGRQWKDIKQKY+ +G+ EDE Sbjct: 40 DAATDRLWDSWNKGRQWKDIKQKYISAGEDEDE 72