BLASTX nr result
ID: Cinnamomum23_contig00054923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00054923 (244 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EUN27925.1| hypothetical protein COCVIDRAFT_96921 [Bipolaris ... 91 3e-16 ref|XP_007692228.1| hypothetical protein COCMIDRAFT_40544 [Bipol... 91 3e-16 ref|XP_007706839.1| hypothetical protein COCCADRAFT_585 [Bipolar... 91 3e-16 gb|EMD89860.1| hypothetical protein COCHEDRAFT_1195167 [Bipolari... 91 3e-16 ref|XP_007698718.1| hypothetical protein COCSADRAFT_86861 [Bipol... 91 3e-16 ref|XP_001791550.1| hypothetical protein SNOG_00883 [Phaeosphaer... 89 1e-15 ref|XP_008031041.1| hypothetical protein SETTUDRAFT_157533 [Seto... 89 1e-15 ref|XP_003299008.1| hypothetical protein PTT_09919 [Pyrenophora ... 89 1e-15 dbj|GAD94361.1| hypothetical protein NFIA_019800 [Byssochlamys s... 88 2e-15 dbj|GAM82620.1| hypothetical protein ANO11243_006020 [fungal sp.... 87 3e-15 gb|KKY19073.1| hypothetical protein UCDDS831_g05705 [Diplodia se... 87 4e-15 gb|KEQ82139.1| hypothetical protein M438DRAFT_376176 [Aureobasid... 87 4e-15 dbj|GAM38093.1| hypothetical protein TCE0_033f08559 [Talaromyces... 87 6e-15 gb|KEQ98923.1| hypothetical protein AUEXF2481DRAFT_26164 [Aureob... 87 6e-15 ref|XP_002484071.1| conserved hypothetical protein [Talaromyces ... 87 6e-15 ref|XP_002150191.1| conserved hypothetical protein [Talaromyces ... 87 6e-15 ref|XP_007580107.1| hypothetical protein UCRNP2_783 [Neofusicocc... 87 6e-15 gb|KEQ65337.1| hypothetical protein M437DRAFT_42988 [Aureobasidi... 86 7e-15 ref|XP_003837996.1| hypothetical protein LEMA_P120430.1 [Leptosp... 86 7e-15 gb|KKY14431.1| hypothetical protein UCRPC4_g06751 [Phaeomoniella... 86 1e-14 >gb|EUN27925.1| hypothetical protein COCVIDRAFT_96921 [Bipolaris victoriae FI3] Length = 764 Score = 90.9 bits (224), Expect = 3e-16 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 P+LPDSTDFVCGTLDEDRP EEAY +E+RRAA+H P PQDIDPTFPTS Sbjct: 485 PELPDSTDFVCGTLDEDRPAEEAYMSTLERRRAAKHKPTPQDIDPTFPTS 534 >ref|XP_007692228.1| hypothetical protein COCMIDRAFT_40544 [Bipolaris oryzae ATCC 44560] gi|576927572|gb|EUC41252.1| hypothetical protein COCMIDRAFT_40544 [Bipolaris oryzae ATCC 44560] Length = 771 Score = 90.9 bits (224), Expect = 3e-16 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 P+LPDSTDFVCGTLDEDRP EEAY +E+RRAA+H P PQDIDPTFPTS Sbjct: 483 PELPDSTDFVCGTLDEDRPAEEAYMSTLERRRAAKHKPTPQDIDPTFPTS 532 >ref|XP_007706839.1| hypothetical protein COCCADRAFT_585 [Bipolaris zeicola 26-R-13] gi|576924764|gb|EUC38872.1| hypothetical protein COCCADRAFT_585 [Bipolaris zeicola 26-R-13] Length = 771 Score = 90.9 bits (224), Expect = 3e-16 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 P+LPDSTDFVCGTLDEDRP EEAY +E+RRAA+H P PQDIDPTFPTS Sbjct: 483 PELPDSTDFVCGTLDEDRPAEEAYMSTLERRRAAKHKPTPQDIDPTFPTS 532 >gb|EMD89860.1| hypothetical protein COCHEDRAFT_1195167 [Bipolaris maydis C5] gi|477592858|gb|ENI09928.1| hypothetical protein COCC4DRAFT_126435 [Bipolaris maydis ATCC 48331] Length = 767 Score = 90.9 bits (224), Expect = 3e-16 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 P+LPDSTDFVCGTLDEDRP EEAY +E+RRAA+H P PQDIDPTFPTS Sbjct: 479 PELPDSTDFVCGTLDEDRPAEEAYMSTLERRRAAKHKPTPQDIDPTFPTS 528 >ref|XP_007698718.1| hypothetical protein COCSADRAFT_86861 [Bipolaris sorokiniana ND90Pr] gi|451852331|gb|EMD65626.1| hypothetical protein COCSADRAFT_86861 [Bipolaris sorokiniana ND90Pr] Length = 770 Score = 90.9 bits (224), Expect = 3e-16 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 P+LPDSTDFVCGTLDEDRP EEAY +E+RRAA+H P PQDIDPTFPTS Sbjct: 482 PELPDSTDFVCGTLDEDRPAEEAYMSTLERRRAAKHKPTPQDIDPTFPTS 531 >ref|XP_001791550.1| hypothetical protein SNOG_00883 [Phaeosphaeria nodorum SN15] gi|111071258|gb|EAT92378.1| hypothetical protein SNOG_00883 [Phaeosphaeria nodorum SN15] Length = 776 Score = 89.0 bits (219), Expect = 1e-15 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 P+LPDSTDFVCGTLDEDRP+E+AY +E+RRAA+H P PQDIDPTFP S Sbjct: 485 PELPDSTDFVCGTLDEDRPLEQAYMSTLERRRAAKHKPTPQDIDPTFPAS 534 >ref|XP_008031041.1| hypothetical protein SETTUDRAFT_157533 [Setosphaeria turcica Et28A] gi|482804518|gb|EOA81630.1| hypothetical protein SETTUDRAFT_157533 [Setosphaeria turcica Et28A] Length = 793 Score = 88.6 bits (218), Expect = 1e-15 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 P+LPDSTDFVCGTLDEDRP E AY +E+RRAA+H P PQDIDPTFPTS Sbjct: 502 PELPDSTDFVCGTLDEDRPAEAAYMSTLERRRAAKHKPTPQDIDPTFPTS 551 >ref|XP_003299008.1| hypothetical protein PTT_09919 [Pyrenophora teres f. teres 0-1] gi|311327423|gb|EFQ92841.1| hypothetical protein PTT_09919 [Pyrenophora teres f. teres 0-1] Length = 780 Score = 88.6 bits (218), Expect = 1e-15 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 P+LPDSTDFVCGTLDEDRP E AY +E+RRAA+H P PQDIDPTFPTS Sbjct: 490 PELPDSTDFVCGTLDEDRPAEAAYMSTLERRRAAKHKPTPQDIDPTFPTS 539 >dbj|GAD94361.1| hypothetical protein NFIA_019800 [Byssochlamys spectabilis No. 5] Length = 749 Score = 88.2 bits (217), Expect = 2e-15 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 P LPDSTDFVCGTLDEDRP+E AYK +E+RR ++HVPIPQDIDP+FPT+ Sbjct: 468 PSLPDSTDFVCGTLDEDRPLEAAYKSCLEQRRLSKHVPIPQDIDPSFPTT 517 >dbj|GAM82620.1| hypothetical protein ANO11243_006020 [fungal sp. No.11243] Length = 763 Score = 87.4 bits (215), Expect = 3e-15 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 P+LPDSTDFVCGTLDEDRP+E+AYK IE+R+AA+H PQDIDPTFPTS Sbjct: 477 PELPDSTDFVCGTLDEDRPLEQAYKTCIEQRKAAKHKVTPQDIDPTFPTS 526 >gb|KKY19073.1| hypothetical protein UCDDS831_g05705 [Diplodia seriata] Length = 763 Score = 87.0 bits (214), Expect = 4e-15 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 P+LPDSTDFVCGTLDEDRP+E+AY +E+RRAA+H PQDIDPTFPTS Sbjct: 484 PELPDSTDFVCGTLDEDRPLEDAYYSALEQRRAAKHKQTPQDIDPTFPTS 533 >gb|KEQ82139.1| hypothetical protein M438DRAFT_376176 [Aureobasidium pullulans EXF-150] Length = 859 Score = 87.0 bits (214), Expect = 4e-15 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 PDLPDSTDFVCGTLDEDRP+E+AY +E+R+AA+H PQDIDPTFPTS Sbjct: 559 PDLPDSTDFVCGTLDEDRPLEQAYIMSLERRKAAKHKAKPQDIDPTFPTS 608 >dbj|GAM38093.1| hypothetical protein TCE0_033f08559 [Talaromyces cellulolyticus] Length = 723 Score = 86.7 bits (213), Expect = 6e-15 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 PDLPDSTDFVCGTLDEDRP+E AY IE+RR +H+P+PQDIDP+FPT+ Sbjct: 448 PDLPDSTDFVCGTLDEDRPLEAAYISCIEERRRKKHIPVPQDIDPSFPTT 497 >gb|KEQ98923.1| hypothetical protein AUEXF2481DRAFT_26164 [Aureobasidium subglaciale EXF-2481] Length = 782 Score = 86.7 bits (213), Expect = 6e-15 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 PDLPDSTDFVCGTLDEDRP+E+AY +E+R+AA+H PQDIDPTFPTS Sbjct: 482 PDLPDSTDFVCGTLDEDRPLEQAYIMSLERRKAAKHKVKPQDIDPTFPTS 531 >ref|XP_002484071.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218717416|gb|EED16837.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 690 Score = 86.7 bits (213), Expect = 6e-15 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 PDLPDSTDFVCGTLDEDRP+E AY IE+RR +H+P+PQDIDP+FPT+ Sbjct: 415 PDLPDSTDFVCGTLDEDRPLEAAYISCIEERRRKKHIPVPQDIDPSFPTT 464 >ref|XP_002150191.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224] gi|210067490|gb|EEA21582.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224] gi|679990126|gb|KFX43016.1| Uncharacterized protein GQ26_0380020 [Talaromyces marneffei PM1] Length = 722 Score = 86.7 bits (213), Expect = 6e-15 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 PDLPDSTDFVCGTLDEDRP+E AY IE+RR +H+P+PQDIDP+FPT+ Sbjct: 449 PDLPDSTDFVCGTLDEDRPLEAAYISCIEERRRKKHIPVPQDIDPSFPTT 498 >ref|XP_007580107.1| hypothetical protein UCRNP2_783 [Neofusicoccum parvum UCRNP2] gi|485928827|gb|EOD52418.1| hypothetical protein UCRNP2_783 [Neofusicoccum parvum UCRNP2] Length = 634 Score = 86.7 bits (213), Expect = 6e-15 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 P+LPDSTDFVCGTLDEDRP+E+AY +E+RRAA+H PQDIDPTFPTS Sbjct: 459 PELPDSTDFVCGTLDEDRPLEDAYYSALEQRRAAKHKMTPQDIDPTFPTS 508 >gb|KEQ65337.1| hypothetical protein M437DRAFT_42988 [Aureobasidium melanogenum CBS 110374] Length = 767 Score = 86.3 bits (212), Expect = 7e-15 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 PDLPDSTDFVCGTLDEDRP+E+AY +E+R+AA+H PQDIDPTFPTS Sbjct: 466 PDLPDSTDFVCGTLDEDRPLEQAYILSLERRKAAKHKAKPQDIDPTFPTS 515 >ref|XP_003837996.1| hypothetical protein LEMA_P120430.1 [Leptosphaeria maculans JN3] gi|312214561|emb|CBX94552.1| hypothetical protein LEMA_P120430.1 [Leptosphaeria maculans JN3] Length = 789 Score = 86.3 bits (212), Expect = 7e-15 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 P+LPDSTDFVCGTLDEDRP E Y +E+RRAA+H P PQDIDPTFPTS Sbjct: 491 PELPDSTDFVCGTLDEDRPAEAMYMATLERRRAAKHKPTPQDIDPTFPTS 540 >gb|KKY14431.1| hypothetical protein UCRPC4_g06751 [Phaeomoniella chlamydospora] Length = 789 Score = 85.9 bits (211), Expect = 1e-14 Identities = 37/50 (74%), Positives = 45/50 (90%) Frame = +1 Query: 4 PDLPDSTDFVCGTLDEDRPIEEAYKQEIEKRRAAQHVPIPQDIDPTFPTS 153 PDLPDSTDFVCGTLDEDRP+E AY +E+++ A+HVPIPQDIDP+FPT+ Sbjct: 465 PDLPDSTDFVCGTLDEDRPLEAAYISCMEQKKRAKHVPIPQDIDPSFPTT 514