BLASTX nr result
ID: Cinnamomum23_contig00054910
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00054910 (473 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009602040.1| PREDICTED: xylosyltransferase 1-like isoform... 58 2e-06 >ref|XP_009602040.1| PREDICTED: xylosyltransferase 1-like isoform X1 [Nicotiana tomentosiformis] gi|697186014|ref|XP_009602041.1| PREDICTED: xylosyltransferase 1-like isoform X2 [Nicotiana tomentosiformis] Length = 422 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +2 Query: 5 EWDWFINLSASDYPLVTQDGEFLVHQETYL 94 EWDWFINLSASDYPLVTQDGE+L+H +++ Sbjct: 167 EWDWFINLSASDYPLVTQDGEYLIHTFSHI 196