BLASTX nr result
ID: Cinnamomum23_contig00054897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00054897 (245 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM86030.1| hypothetical protein ANO11243_040400 [fungal sp.... 157 3e-36 gb|EKG22171.1| Cytochrome b5 [Macrophomina phaseolina MS6] 149 9e-34 ref|XP_008720546.1| hypothetical protein HMPREF1541_08002 [Cyphe... 148 2e-33 gb|KKY19346.1| putative fumarate reductase [Diplodia seriata] 147 2e-33 ref|XP_002487498.1| fumarate reductase Osm1, putative [Talaromyc... 147 2e-33 ref|XP_006695827.1| fumarate reductase-like protein [Chaetomium ... 147 2e-33 ref|XP_007582067.1| putative fumarate reductase protein [Neofusi... 147 3e-33 ref|XP_001262094.1| fumarate reductase Osm1, putative [Neosartor... 146 5e-33 ref|XP_007779558.1| hypothetical protein W97_03472 [Coniosporium... 146 6e-33 dbj|GAA89238.1| fumarate reductase Osm1 [Aspergillus kawachii IF... 146 6e-33 gb|EHA21461.1| hypothetical protein ASPNIDRAFT_205005 [Aspergill... 146 6e-33 ref|XP_001398015.1| fumarate reductase [Aspergillus niger CBS 51... 146 6e-33 gb|KEY82817.1| fumarate reductase Osm1 [Aspergillus fumigatus va... 145 8e-33 ref|XP_747355.1| fumarate reductase Osm1 [Aspergillus fumigatus ... 145 8e-33 gb|KKK25831.1| hypothetical protein ARAM_000499 [Aspergillus ram... 145 1e-32 gb|KKK17293.1| hypothetical protein AOCH_001805 [Aspergillus och... 145 1e-32 emb|CRG91660.1| hypothetical protein PISL3812_08710 [Talaromyces... 145 1e-32 ref|XP_659147.1| hypothetical protein AN1543.2 [Aspergillus nidu... 145 1e-32 ref|XP_001276659.1| fumarate reductase Osm1, putative [Aspergill... 145 1e-32 ref|XP_001216364.1| hypothetical protein ATEG_07743 [Aspergillus... 145 1e-32 >dbj|GAM86030.1| hypothetical protein ANO11243_040400 [fungal sp. No.11243] Length = 630 Score = 157 bits (396), Expect = 3e-36 Identities = 75/77 (97%), Positives = 76/77 (98%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG Sbjct: 272 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 331 Query: 182 RGLMKKMTGKELAKEIG 232 RGLMKKM+GKEL KEIG Sbjct: 332 RGLMKKMSGKELIKEIG 348 >gb|EKG22171.1| Cytochrome b5 [Macrophomina phaseolina MS6] Length = 631 Score = 149 bits (375), Expect = 9e-34 Identities = 70/77 (90%), Positives = 76/77 (98%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGGLLLNSKG+RFSDELGHRDYVSG+M++EK++G WPIRLVLNSKASNVLDFHTRHYSG Sbjct: 273 GEGGLLLNSKGQRFSDELGHRDYVSGKMWEEKEKGLWPIRLVLNSKASNVLDFHTRHYSG 332 Query: 182 RGLMKKMTGKELAKEIG 232 RGLMKKMTGKELAKEIG Sbjct: 333 RGLMKKMTGKELAKEIG 349 >ref|XP_008720546.1| hypothetical protein HMPREF1541_08002 [Cyphellophora europaea CBS 101466] gi|568114392|gb|ETN37014.1| hypothetical protein HMPREF1541_08002 [Cyphellophora europaea CBS 101466] Length = 634 Score = 148 bits (373), Expect = 2e-33 Identities = 70/81 (86%), Positives = 76/81 (93%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGGLLLN+KGERF D+LGHRDYVSG+M++EK+ GRWPIRLVLNSKASNVLDFHTRHYSG Sbjct: 273 GEGGLLLNNKGERFCDDLGHRDYVSGKMWEEKEAGRWPIRLVLNSKASNVLDFHTRHYSG 332 Query: 182 RGLMKKMTGKELAKEIGITPE 244 RGLMKKMTGKELAKEIG E Sbjct: 333 RGLMKKMTGKELAKEIGCGEE 353 >gb|KKY19346.1| putative fumarate reductase [Diplodia seriata] Length = 633 Score = 147 bits (372), Expect = 2e-33 Identities = 69/77 (89%), Positives = 75/77 (97%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGGLLLN KG+RFSDELGHRDYVSG+M++EK++G WPIRLVLNSKASNVLDFHTRHYSG Sbjct: 273 GEGGLLLNGKGQRFSDELGHRDYVSGKMWEEKEKGTWPIRLVLNSKASNVLDFHTRHYSG 332 Query: 182 RGLMKKMTGKELAKEIG 232 RGLMKKMTGKELAKEIG Sbjct: 333 RGLMKKMTGKELAKEIG 349 >ref|XP_002487498.1| fumarate reductase Osm1, putative [Talaromyces stipitatus ATCC 10500] gi|218713963|gb|EED13387.1| fumarate reductase Osm1, putative [Talaromyces stipitatus ATCC 10500] Length = 628 Score = 147 bits (372), Expect = 2e-33 Identities = 70/77 (90%), Positives = 75/77 (97%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGGLLLNS GERFSDELGHRDYVSG+M+ EK++G+WPIRLVLNSKASNVLDFHTRHYSG Sbjct: 272 GEGGLLLNSDGERFSDELGHRDYVSGQMWKEKEKGKWPIRLVLNSKASNVLDFHTRHYSG 331 Query: 182 RGLMKKMTGKELAKEIG 232 RGLMKKMTGKELAKEIG Sbjct: 332 RGLMKKMTGKELAKEIG 348 >ref|XP_006695827.1| fumarate reductase-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340923979|gb|EGS18882.1| fumarate reductase-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 624 Score = 147 bits (372), Expect = 2e-33 Identities = 69/81 (85%), Positives = 75/81 (92%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGG+LLNS G+RF DELGHRDYVSG MF EK++G+WPIRLVLNSKASNVLDFHTRHYSG Sbjct: 273 GEGGILLNSDGDRFCDELGHRDYVSGMMFKEKEKGKWPIRLVLNSKASNVLDFHTRHYSG 332 Query: 182 RGLMKKMTGKELAKEIGITPE 244 RGLM+KMTG ELAKEIG TPE Sbjct: 333 RGLMRKMTGHELAKEIGCTPE 353 >ref|XP_007582067.1| putative fumarate reductase protein [Neofusicoccum parvum UCRNP2] gi|485926095|gb|EOD50467.1| putative fumarate reductase protein [Neofusicoccum parvum UCRNP2] Length = 633 Score = 147 bits (371), Expect = 3e-33 Identities = 69/77 (89%), Positives = 75/77 (97%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGGLLLN KG+RFSDELGHRDYVSG+M++EK++G WPIRLVLNSKASNVLDFHTRHYSG Sbjct: 273 GEGGLLLNGKGQRFSDELGHRDYVSGKMWEEKEKGLWPIRLVLNSKASNVLDFHTRHYSG 332 Query: 182 RGLMKKMTGKELAKEIG 232 RGLMKKMTGKELAKEIG Sbjct: 333 RGLMKKMTGKELAKEIG 349 >ref|XP_001262094.1| fumarate reductase Osm1, putative [Neosartorya fischeri NRRL 181] gi|119410250|gb|EAW20197.1| fumarate reductase Osm1, putative [Neosartorya fischeri NRRL 181] Length = 630 Score = 146 bits (369), Expect = 5e-33 Identities = 69/77 (89%), Positives = 75/77 (97%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGGLLLNS G+RFSDELGHRDYVSG+M+ EK++G+WPIRLVLNSKASNVLDFHTRHYSG Sbjct: 274 GEGGLLLNSDGQRFSDELGHRDYVSGQMWKEKEKGKWPIRLVLNSKASNVLDFHTRHYSG 333 Query: 182 RGLMKKMTGKELAKEIG 232 RGLMKKMTGKELAKEIG Sbjct: 334 RGLMKKMTGKELAKEIG 350 >ref|XP_007779558.1| hypothetical protein W97_03472 [Coniosporium apollinis CBS 100218] gi|494827251|gb|EON64241.1| hypothetical protein W97_03472 [Coniosporium apollinis CBS 100218] Length = 640 Score = 146 bits (368), Expect = 6e-33 Identities = 68/77 (88%), Positives = 76/77 (98%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGGLLLNSKG+RFSDELGHRDYVSG+M++EK++G+WPIRLVLNSKASNVLDFHTRHYSG Sbjct: 272 GEGGLLLNSKGQRFSDELGHRDYVSGKMWEEKEKGQWPIRLVLNSKASNVLDFHTRHYSG 331 Query: 182 RGLMKKMTGKELAKEIG 232 RGLMKKM+G ELAKEIG Sbjct: 332 RGLMKKMSGAELAKEIG 348 >dbj|GAA89238.1| fumarate reductase Osm1 [Aspergillus kawachii IFO 4308] Length = 633 Score = 146 bits (368), Expect = 6e-33 Identities = 68/77 (88%), Positives = 75/77 (97%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGGLLLNS G+RFSDELGHRDYVSG+M+ EK++G+WPIRL+LNSKASNVLDFHTRHYSG Sbjct: 274 GEGGLLLNSDGQRFSDELGHRDYVSGQMWKEKEKGKWPIRLILNSKASNVLDFHTRHYSG 333 Query: 182 RGLMKKMTGKELAKEIG 232 RGLMKKMTGKELAKEIG Sbjct: 334 RGLMKKMTGKELAKEIG 350 >gb|EHA21461.1| hypothetical protein ASPNIDRAFT_205005 [Aspergillus niger ATCC 1015] Length = 633 Score = 146 bits (368), Expect = 6e-33 Identities = 68/77 (88%), Positives = 75/77 (97%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGGLLLNS G+RFSDELGHRDYVSG+M+ EK++G+WPIRL+LNSKASNVLDFHTRHYSG Sbjct: 274 GEGGLLLNSDGQRFSDELGHRDYVSGQMWKEKEKGKWPIRLILNSKASNVLDFHTRHYSG 333 Query: 182 RGLMKKMTGKELAKEIG 232 RGLMKKMTGKELAKEIG Sbjct: 334 RGLMKKMTGKELAKEIG 350 >ref|XP_001398015.1| fumarate reductase [Aspergillus niger CBS 513.88] gi|134083573|emb|CAL00488.1| unnamed protein product [Aspergillus niger] Length = 629 Score = 146 bits (368), Expect = 6e-33 Identities = 68/77 (88%), Positives = 75/77 (97%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGGLLLNS G+RFSDELGHRDYVSG+M+ EK++G+WPIRL+LNSKASNVLDFHTRHYSG Sbjct: 274 GEGGLLLNSDGQRFSDELGHRDYVSGQMWKEKEKGKWPIRLILNSKASNVLDFHTRHYSG 333 Query: 182 RGLMKKMTGKELAKEIG 232 RGLMKKMTGKELAKEIG Sbjct: 334 RGLMKKMTGKELAKEIG 350 >gb|KEY82817.1| fumarate reductase Osm1 [Aspergillus fumigatus var. RP-2014] Length = 630 Score = 145 bits (367), Expect = 8e-33 Identities = 68/77 (88%), Positives = 75/77 (97%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGG+LLNS G+RFSDELGHRDYVSG+M+ EK++G+WPIRLVLNSKASNVLDFHTRHYSG Sbjct: 274 GEGGILLNSDGQRFSDELGHRDYVSGQMWKEKEKGKWPIRLVLNSKASNVLDFHTRHYSG 333 Query: 182 RGLMKKMTGKELAKEIG 232 RGLMKKMTGKELAKEIG Sbjct: 334 RGLMKKMTGKELAKEIG 350 >ref|XP_747355.1| fumarate reductase Osm1 [Aspergillus fumigatus Af293] gi|66844981|gb|EAL85317.1| fumarate reductase Osm1, putative [Aspergillus fumigatus Af293] gi|159123640|gb|EDP48759.1| fumarate reductase Osm1, putative [Aspergillus fumigatus A1163] gi|846910720|gb|KMK56619.1| fumarate reductase Osm1 [Aspergillus fumigatus Z5] Length = 630 Score = 145 bits (367), Expect = 8e-33 Identities = 68/77 (88%), Positives = 75/77 (97%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGG+LLNS G+RFSDELGHRDYVSG+M+ EK++G+WPIRLVLNSKASNVLDFHTRHYSG Sbjct: 274 GEGGILLNSDGQRFSDELGHRDYVSGQMWKEKEKGKWPIRLVLNSKASNVLDFHTRHYSG 333 Query: 182 RGLMKKMTGKELAKEIG 232 RGLMKKMTGKELAKEIG Sbjct: 334 RGLMKKMTGKELAKEIG 350 >gb|KKK25831.1| hypothetical protein ARAM_000499 [Aspergillus rambellii] Length = 626 Score = 145 bits (366), Expect = 1e-32 Identities = 69/77 (89%), Positives = 74/77 (96%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGGLLLNS GERFSDELGHRDYVSG+M+ EK++ +WPIRLVLNSKASNVLDFHTRHYSG Sbjct: 272 GEGGLLLNSDGERFSDELGHRDYVSGQMWKEKEKNKWPIRLVLNSKASNVLDFHTRHYSG 331 Query: 182 RGLMKKMTGKELAKEIG 232 RGLMKKMTGKELAKEIG Sbjct: 332 RGLMKKMTGKELAKEIG 348 >gb|KKK17293.1| hypothetical protein AOCH_001805 [Aspergillus ochraceoroseus] Length = 626 Score = 145 bits (366), Expect = 1e-32 Identities = 69/77 (89%), Positives = 74/77 (96%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGGLLLNS GERFSDELGHRDYVSG+M+ EK++ +WPIRLVLNSKASNVLDFHTRHYSG Sbjct: 272 GEGGLLLNSDGERFSDELGHRDYVSGQMWKEKEKNKWPIRLVLNSKASNVLDFHTRHYSG 331 Query: 182 RGLMKKMTGKELAKEIG 232 RGLMKKMTGKELAKEIG Sbjct: 332 RGLMKKMTGKELAKEIG 348 >emb|CRG91660.1| hypothetical protein PISL3812_08710 [Talaromyces islandicus] Length = 629 Score = 145 bits (366), Expect = 1e-32 Identities = 68/77 (88%), Positives = 75/77 (97%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGGLLLNS G+RFSDELGHRDYVSG+M+ EK++G+WPIRLVLNSKASNVLDFHTRHYSG Sbjct: 272 GEGGLLLNSDGQRFSDELGHRDYVSGQMWKEKEKGKWPIRLVLNSKASNVLDFHTRHYSG 331 Query: 182 RGLMKKMTGKELAKEIG 232 RGLMKK+TGKELAKEIG Sbjct: 332 RGLMKKLTGKELAKEIG 348 >ref|XP_659147.1| hypothetical protein AN1543.2 [Aspergillus nidulans FGSC A4] gi|40745094|gb|EAA64250.1| hypothetical protein AN1543.2 [Aspergillus nidulans FGSC A4] gi|259486869|tpe|CBF85078.1| TPA: hypothetical fumarate reductase (Eurofung) [Aspergillus nidulans FGSC A4] Length = 627 Score = 145 bits (366), Expect = 1e-32 Identities = 69/77 (89%), Positives = 74/77 (96%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGGLLLNS GERFSDELGHRDYVSG+M+ EK++G+WPIRLVLNSKAS VLDFHTRHYSG Sbjct: 272 GEGGLLLNSDGERFSDELGHRDYVSGQMWKEKEKGKWPIRLVLNSKASKVLDFHTRHYSG 331 Query: 182 RGLMKKMTGKELAKEIG 232 RGLMKKMTGKELAKEIG Sbjct: 332 RGLMKKMTGKELAKEIG 348 >ref|XP_001276659.1| fumarate reductase Osm1, putative [Aspergillus clavatus NRRL 1] gi|119404871|gb|EAW15233.1| fumarate reductase Osm1, putative [Aspergillus clavatus NRRL 1] Length = 629 Score = 145 bits (366), Expect = 1e-32 Identities = 68/77 (88%), Positives = 75/77 (97%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGGLLLNS G+RFSDELGHRDYVSG+M+ EK++G+WPIRLVLNSKASNVLDFHTRHYSG Sbjct: 274 GEGGLLLNSDGQRFSDELGHRDYVSGQMWKEKEKGKWPIRLVLNSKASNVLDFHTRHYSG 333 Query: 182 RGLMKKMTGKELAKEIG 232 RGLM+KMTGKELAKEIG Sbjct: 334 RGLMRKMTGKELAKEIG 350 >ref|XP_001216364.1| hypothetical protein ATEG_07743 [Aspergillus terreus NIH2624] gi|114190305|gb|EAU32005.1| hypothetical protein ATEG_07743 [Aspergillus terreus NIH2624] Length = 626 Score = 145 bits (366), Expect = 1e-32 Identities = 68/77 (88%), Positives = 75/77 (97%) Frame = +2 Query: 2 GEGGLLLNSKGERFSDELGHRDYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSG 181 GEGGLLLNS G+RFSDELGHRDYVSG+M+ EK++G+WPIRLVLNSKASNVLDFHTRHYSG Sbjct: 274 GEGGLLLNSDGQRFSDELGHRDYVSGQMWKEKEKGKWPIRLVLNSKASNVLDFHTRHYSG 333 Query: 182 RGLMKKMTGKELAKEIG 232 RGLM+KMTGKELAKEIG Sbjct: 334 RGLMRKMTGKELAKEIG 350