BLASTX nr result
ID: Cinnamomum23_contig00054825
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00054825 (313 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007780270.1| hypothetical protein W97_04188 [Coniosporium... 56 8e-06 >ref|XP_007780270.1| hypothetical protein W97_04188 [Coniosporium apollinis CBS 100218] gi|494828081|gb|EON64953.1| hypothetical protein W97_04188 [Coniosporium apollinis CBS 100218] Length = 311 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -3 Query: 311 QDVCSSDFARSVASLCAEKGEFLRDRAHVRIAPENAIRYTARLVSQFMLSFW 156 +D +S F R+V+SL EK +FL +R HV IA +N RYT+RL ++F+LSFW Sbjct: 257 KDQRTSRFVRNVSSLVKEKFDFLLERQHVNIAVDNRGRYTSRLAARFLLSFW 308