BLASTX nr result
ID: Cinnamomum23_contig00054531
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00054531 (482 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010456900.1| PREDICTED: uncharacterized protein LOC104738... 46 2e-06 >ref|XP_010456900.1| PREDICTED: uncharacterized protein LOC104738422 [Camelina sativa] Length = 255 Score = 45.8 bits (107), Expect(2) = 2e-06 Identities = 20/50 (40%), Positives = 28/50 (56%) Frame = -2 Query: 154 LFIHGKLKTKDFLLQPNVDCDTSCMLCDCTWESGSHLMLHCPISQTVWSL 5 LF+ + T+D LL + D SCMLC ES H+ CP S ++WS+ Sbjct: 109 LFVLDRCPTRDRLLNWGLQVDPSCMLCTSMPESRDHIFFECPFSWSIWSV 158 Score = 32.3 bits (72), Expect(2) = 2e-06 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 215 WALLIWFQGCIKKHSICTWTFI 150 W ++WF G I KH TW F+ Sbjct: 90 WHTIVWFSGGIPKHKFLTWLFV 111