BLASTX nr result
ID: Cinnamomum23_contig00053356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00053356 (253 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008796519.1| PREDICTED: endoribonuclease Dicer homolog 3b... 63 9e-08 >ref|XP_008796519.1| PREDICTED: endoribonuclease Dicer homolog 3b-like [Phoenix dactylifera] Length = 1832 Score = 62.8 bits (151), Expect = 9e-08 Identities = 35/80 (43%), Positives = 53/80 (66%), Gaps = 2/80 (2%) Frame = -1 Query: 235 ISRNVIFFQHQYFFQTHLDSSTVKNMSFLPAFFLILLPYQGLKPGLVYTRRQTPIHLANG 56 +SRNV+FF +QYFFQ+++ SS+ +++ LP+F I + KP +VY RRQ P L++ Sbjct: 143 VSRNVVFFDNQYFFQSNVASSS--DLAMLPSFDDIYHSIKRFKPNIVYKRRQPPQPLSDT 200 Query: 55 PPSPDPLV--LQRSTRSICP 2 P P+P V +RSTR+ P Sbjct: 201 DPPPEPAVPAPRRSTRASHP 220