BLASTX nr result
ID: Cinnamomum23_contig00053216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00053216 (324 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007715642.1| hypothetical protein COCCADRAFT_104888 [Bipo... 86 9e-15 gb|EUN33077.1| hypothetical protein COCVIDRAFT_83235 [Bipolaris ... 85 2e-14 ref|XP_003304982.1| hypothetical protein PTT_17716 [Pyrenophora ... 85 2e-14 ref|XP_007694861.1| hypothetical protein COCSADRAFT_211526 [Bipo... 84 3e-14 ref|XP_007682882.1| hypothetical protein COCMIDRAFT_81550 [Bipol... 84 4e-14 ref|XP_007930574.1| hypothetical protein MYCFIDRAFT_51582 [Pseud... 84 5e-14 gb|ENI10676.1| hypothetical protein COCC4DRAFT_46376 [Bipolaris ... 83 6e-14 gb|EME40469.1| hypothetical protein DOTSEDRAFT_74144 [Dothistrom... 80 5e-13 ref|XP_003837442.1| hypothetical protein LEMA_P036760.1 [Leptosp... 80 7e-13 ref|XP_002841526.1| hypothetical protein [Tuber melanosporum Mel... 78 2e-12 ref|XP_002844075.1| conserved hypothetical protein [Arthroderma ... 78 2e-12 gb|EZF71505.1| hypothetical protein H105_06457 [Trichophyton sou... 78 3e-12 gb|EZF13021.1| hypothetical protein H100_06452 [Trichophyton rub... 78 3e-12 ref|XP_003237080.1| hypothetical protein TERG_01802 [Trichophyto... 78 3e-12 gb|EZF29334.1| hypothetical protein H101_06988 [Trichophyton int... 77 3e-12 gb|EGE01277.1| hypothetical protein TEQG_00330 [Trichophyton equ... 77 3e-12 gb|EGD95877.1| hypothetical protein TESG_03341 [Trichophyton ton... 77 3e-12 ref|XP_001804230.1| hypothetical protein SNOG_14031 [Phaeosphaer... 77 3e-12 ref|XP_008025440.1| hypothetical protein SETTUDRAFT_163004 [Seto... 77 6e-12 ref|XP_011124299.1| hypothetical protein AOL_s00097g164 [Arthrob... 76 8e-12 >ref|XP_007715642.1| hypothetical protein COCCADRAFT_104888 [Bipolaris zeicola 26-R-13] gi|576915770|gb|EUC30055.1| hypothetical protein COCCADRAFT_104888 [Bipolaris zeicola 26-R-13] Length = 351 Score = 85.9 bits (211), Expect = 9e-15 Identities = 35/64 (54%), Positives = 47/64 (73%) Frame = +3 Query: 3 HKCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQ 182 H CPY C KEF R+AD VRH++ VH KR+ ++C+RC A F RKDTL RH+ DGC +R + Sbjct: 281 HVCPYEACGKEFVRRADLVRHDECVHKKRRPWQCERCSAVFGRKDTLARHRSDGCSRRTE 340 Query: 183 LVQS 194 ++ S Sbjct: 341 VISS 344 >gb|EUN33077.1| hypothetical protein COCVIDRAFT_83235 [Bipolaris victoriae FI3] Length = 351 Score = 84.7 bits (208), Expect = 2e-14 Identities = 34/64 (53%), Positives = 47/64 (73%) Frame = +3 Query: 3 HKCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQ 182 H CPY C KEF R+AD VRH++ VH KR+ ++C++C A F RKDTL RH+ DGC +R + Sbjct: 281 HVCPYEACGKEFVRRADLVRHDECVHKKRRPWQCEKCSAVFGRKDTLTRHRSDGCSRRTE 340 Query: 183 LVQS 194 ++ S Sbjct: 341 VISS 344 >ref|XP_003304982.1| hypothetical protein PTT_17716 [Pyrenophora teres f. teres 0-1] gi|311318172|gb|EFQ86919.1| hypothetical protein PTT_17716 [Pyrenophora teres f. teres 0-1] Length = 356 Score = 84.7 bits (208), Expect = 2e-14 Identities = 34/60 (56%), Positives = 45/60 (75%) Frame = +3 Query: 9 CPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQLV 188 CP+P CDK F RK D RH+ +VH K K F C RC + FPRKDTL+RH+ DGCP+R++++ Sbjct: 279 CPHPGCDKRFVRKTDLARHDISVHQKVKPFHCTRCSSAFPRKDTLRRHEDDGCPRRNEVM 338 >ref|XP_007694861.1| hypothetical protein COCSADRAFT_211526 [Bipolaris sorokiniana ND90Pr] gi|451856284|gb|EMD69575.1| hypothetical protein COCSADRAFT_211526 [Bipolaris sorokiniana ND90Pr] Length = 351 Score = 84.3 bits (207), Expect = 3e-14 Identities = 33/64 (51%), Positives = 47/64 (73%) Frame = +3 Query: 3 HKCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQ 182 H CPY C KEF R+AD +RH++ VH K++ ++C++C A F RKDTL RHK DGC +R + Sbjct: 281 HVCPYEACGKEFVRRADLIRHDECVHKKKRPWQCEKCSAMFGRKDTLTRHKSDGCSRRTE 340 Query: 183 LVQS 194 ++ S Sbjct: 341 VMSS 344 >ref|XP_007682882.1| hypothetical protein COCMIDRAFT_81550 [Bipolaris oryzae ATCC 44560] gi|576937066|gb|EUC50556.1| hypothetical protein COCMIDRAFT_81550 [Bipolaris oryzae ATCC 44560] Length = 348 Score = 84.0 bits (206), Expect = 4e-14 Identities = 34/64 (53%), Positives = 47/64 (73%) Frame = +3 Query: 3 HKCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQ 182 H CP+ C KEF R+AD VRH++ VH KRK ++C++C A F RKDTL RH+ DGC +R + Sbjct: 278 HVCPHEACGKEFVRRADLVRHDECVHKKRKPWQCEKCSAVFGRKDTLARHRSDGCSRRTE 337 Query: 183 LVQS 194 ++ S Sbjct: 338 VISS 341 >ref|XP_007930574.1| hypothetical protein MYCFIDRAFT_51582 [Pseudocercospora fijiensis CIRAD86] gi|452978486|gb|EME78249.1| hypothetical protein MYCFIDRAFT_51582 [Pseudocercospora fijiensis CIRAD86] Length = 367 Score = 83.6 bits (205), Expect = 5e-14 Identities = 33/61 (54%), Positives = 43/61 (70%) Frame = +3 Query: 3 HKCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQ 182 H CPYP+C + F R+ D +RHE +VHLK + F C C + F RKDTL+RH DGCP+R Q Sbjct: 264 HACPYPDCKRRFVRRTDLMRHEQSVHLKTRNFHCPLCFSAFARKDTLRRHVDDGCPRREQ 323 Query: 183 L 185 + Sbjct: 324 V 324 >gb|ENI10676.1| hypothetical protein COCC4DRAFT_46376 [Bipolaris maydis ATCC 48331] Length = 350 Score = 83.2 bits (204), Expect = 6e-14 Identities = 34/64 (53%), Positives = 47/64 (73%) Frame = +3 Query: 3 HKCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQ 182 H CPY C KEF R+AD VRH++ VH KR+ ++C++C A F RKDTL RH+ DGC +R + Sbjct: 280 HVCPYEACGKEFVRRADLVRHDECVHKKRRPWQCEKCSAVFGRKDTLTRHRIDGCSRRME 339 Query: 183 LVQS 194 ++ S Sbjct: 340 VISS 343 >gb|EME40469.1| hypothetical protein DOTSEDRAFT_74144 [Dothistroma septosporum NZE10] Length = 400 Score = 80.1 bits (196), Expect = 5e-13 Identities = 31/65 (47%), Positives = 45/65 (69%) Frame = +3 Query: 3 HKCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQ 182 H C YP+C + F R+ D +RHE +VHLK ++++C C F RKDTL+RH DGCP+R + Sbjct: 335 HACQYPDCTRRFVRRTDLLRHEQSVHLKERKYRCPLCYGSFARKDTLRRHVDDGCPRRPE 394 Query: 183 LVQSL 197 + + L Sbjct: 395 MRKRL 399 >ref|XP_003837442.1| hypothetical protein LEMA_P036760.1 [Leptosphaeria maculans JN3] gi|312214000|emb|CBX94002.1| hypothetical protein LEMA_P036760.1 [Leptosphaeria maculans JN3] Length = 347 Score = 79.7 bits (195), Expect = 7e-13 Identities = 30/61 (49%), Positives = 44/61 (72%) Frame = +3 Query: 3 HKCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQ 182 H C +P CD++F RK D RH+ + H + ++F+C C + F RKDTL+RH+ DGCP+RHQ Sbjct: 274 HVCTHPGCDRKFVRKTDLTRHDQSRHQQARQFRCSLCPSAFARKDTLRRHETDGCPRRHQ 333 Query: 183 L 185 + Sbjct: 334 I 334 >ref|XP_002841526.1| hypothetical protein [Tuber melanosporum Mel28] gi|295637768|emb|CAZ85717.1| unnamed protein product [Tuber melanosporum] Length = 317 Score = 78.2 bits (191), Expect = 2e-12 Identities = 31/58 (53%), Positives = 40/58 (68%) Frame = +3 Query: 3 HKCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKR 176 H CP +C K F R+ D RH+ VH K K+F+C+ C+ F RKDTL+RH+ DGCPKR Sbjct: 187 HVCPVDDCKKAFVRRTDLTRHQQCVHAKDKKFRCELCNNMFARKDTLRRHEDDGCPKR 244 >ref|XP_002844075.1| conserved hypothetical protein [Arthroderma otae CBS 113480] gi|238845377|gb|EEQ35039.1| conserved hypothetical protein [Arthroderma otae CBS 113480] Length = 428 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/65 (50%), Positives = 44/65 (67%) Frame = +3 Query: 3 HKCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQ 182 HKC + +C +F RK D +RH D+VH K KRF C+ C RF R+DTL+RH+ DGC + Q Sbjct: 292 HKCTFGQCTNKFSRKTDLIRHVDSVHKKLKRFGCEMCGHRFARQDTLRRHREDGCRRYQQ 351 Query: 183 LVQSL 197 Q+L Sbjct: 352 HRQAL 356 >gb|EZF71505.1| hypothetical protein H105_06457 [Trichophyton soudanense CBS 452.61] gi|607974363|gb|EZG03624.1| hypothetical protein H106_06287 [Trichophyton rubrum CBS 735.88] Length = 433 Score = 77.8 bits (190), Expect = 3e-12 Identities = 33/65 (50%), Positives = 44/65 (67%) Frame = +3 Query: 3 HKCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQ 182 HKC +C +F RK D +RH D+VH K KRF C +C RF R+DTL+RH+ DGC ++ Q Sbjct: 293 HKCTIGQCSNKFSRKTDLIRHIDSVHKKLKRFGCDQCGHRFARQDTLRRHREDGCRRQQQ 352 Query: 183 LVQSL 197 Q+L Sbjct: 353 HRQAL 357 >gb|EZF13021.1| hypothetical protein H100_06452 [Trichophyton rubrum MR850] gi|607901799|gb|EZF39411.1| hypothetical protein H102_06418 [Trichophyton rubrum CBS 100081] gi|607913942|gb|EZF50064.1| hypothetical protein H103_06446 [Trichophyton rubrum CBS 288.86] gi|607925953|gb|EZF60642.1| hypothetical protein H104_06430 [Trichophyton rubrum CBS 289.86] gi|607949963|gb|EZF81990.1| hypothetical protein H110_06441 [Trichophyton rubrum MR1448] gi|607962095|gb|EZF92657.1| hypothetical protein H113_06491 [Trichophyton rubrum MR1459] gi|607986059|gb|EZG14190.1| hypothetical protein H107_06589 [Trichophyton rubrum CBS 202.88] gi|633056112|gb|KDB31186.1| hypothetical protein H112_06438 [Trichophyton rubrum D6] gi|861304315|gb|KMQ48410.1| Zinc finger, C2H2 [Trichophyton rubrum] Length = 433 Score = 77.8 bits (190), Expect = 3e-12 Identities = 33/65 (50%), Positives = 44/65 (67%) Frame = +3 Query: 3 HKCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQ 182 HKC +C +F RK D +RH D+VH K KRF C +C RF R+DTL+RH+ DGC ++ Q Sbjct: 293 HKCTIGQCSNKFSRKTDLIRHIDSVHKKLKRFGCDQCGHRFARQDTLRRHREDGCRRQQQ 352 Query: 183 LVQSL 197 Q+L Sbjct: 353 HRQAL 357 >ref|XP_003237080.1| hypothetical protein TERG_01802 [Trichophyton rubrum CBS 118892] gi|326460078|gb|EGD85531.1| hypothetical protein TERG_01802 [Trichophyton rubrum CBS 118892] Length = 432 Score = 77.8 bits (190), Expect = 3e-12 Identities = 33/65 (50%), Positives = 44/65 (67%) Frame = +3 Query: 3 HKCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQ 182 HKC +C +F RK D +RH D+VH K KRF C +C RF R+DTL+RH+ DGC ++ Q Sbjct: 293 HKCTIGQCSNKFSRKTDLIRHIDSVHKKLKRFGCDQCGHRFARQDTLRRHREDGCRRQQQ 352 Query: 183 LVQSL 197 Q+L Sbjct: 353 HRQAL 357 >gb|EZF29334.1| hypothetical protein H101_06988 [Trichophyton interdigitale H6] gi|633046906|gb|KDB23481.1| hypothetical protein H109_04609 [Trichophyton interdigitale MR816] Length = 433 Score = 77.4 bits (189), Expect = 3e-12 Identities = 33/65 (50%), Positives = 44/65 (67%) Frame = +3 Query: 3 HKCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQ 182 HKC +C +F RK D +RH D+VH K KRF C +C RF R+DTL+RH+ DGC ++ Q Sbjct: 293 HKCTIGQCTNKFSRKTDLIRHIDSVHKKLKRFGCDQCGHRFARQDTLRRHREDGCRRQQQ 352 Query: 183 LVQSL 197 Q+L Sbjct: 353 HRQAL 357 >gb|EGE01277.1| hypothetical protein TEQG_00330 [Trichophyton equinum CBS 127.97] Length = 433 Score = 77.4 bits (189), Expect = 3e-12 Identities = 33/65 (50%), Positives = 44/65 (67%) Frame = +3 Query: 3 HKCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQ 182 HKC +C +F RK D +RH D+VH K KRF C +C RF R+DTL+RH+ DGC ++ Q Sbjct: 293 HKCTVGQCTNKFSRKTDLIRHIDSVHKKLKRFGCDQCGHRFARQDTLRRHREDGCRRQQQ 352 Query: 183 LVQSL 197 Q+L Sbjct: 353 HRQAL 357 >gb|EGD95877.1| hypothetical protein TESG_03341 [Trichophyton tonsurans CBS 112818] Length = 438 Score = 77.4 bits (189), Expect = 3e-12 Identities = 33/65 (50%), Positives = 44/65 (67%) Frame = +3 Query: 3 HKCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQ 182 HKC +C +F RK D +RH D+VH K KRF C +C RF R+DTL+RH+ DGC ++ Q Sbjct: 298 HKCTVGQCTNKFSRKTDLIRHIDSVHKKLKRFGCDQCGHRFARQDTLRRHREDGCRRQQQ 357 Query: 183 LVQSL 197 Q+L Sbjct: 358 HRQAL 362 >ref|XP_001804230.1| hypothetical protein SNOG_14031 [Phaeosphaeria nodorum SN15] gi|111057536|gb|EAT78656.1| hypothetical protein SNOG_14031 [Phaeosphaeria nodorum SN15] Length = 363 Score = 77.4 bits (189), Expect = 3e-12 Identities = 31/59 (52%), Positives = 41/59 (69%) Frame = +3 Query: 9 CPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQL 185 CP C +EF RK D RH+ +VH K + +KC RC FPRKDTL+RH+ DGC +R+Q+ Sbjct: 283 CPVEGCSQEFRRKTDLARHDQSVHQKVRPYKCSRCSRSFPRKDTLRRHEDDGCTRRNQV 341 >ref|XP_008025440.1| hypothetical protein SETTUDRAFT_163004 [Setosphaeria turcica Et28A] gi|482810066|gb|EOA86872.1| hypothetical protein SETTUDRAFT_163004 [Setosphaeria turcica Et28A] Length = 348 Score = 76.6 bits (187), Expect = 6e-12 Identities = 32/61 (52%), Positives = 42/61 (68%) Frame = +3 Query: 3 HKCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKRHQ 182 H C Y C K+F RK D VRH +VH K+K + C +C + F RKDTL+RH+ DGCP+R + Sbjct: 279 HVCLYTNCGKQFVRKTDLVRHRASVHEKQKPWPCSKCSSVFARKDTLRRHESDGCPRRTE 338 Query: 183 L 185 L Sbjct: 339 L 339 >ref|XP_011124299.1| hypothetical protein AOL_s00097g164 [Arthrobotrys oligospora ATCC 24927] gi|345564137|gb|EGX47118.1| hypothetical protein AOL_s00097g164 [Arthrobotrys oligospora ATCC 24927] Length = 381 Score = 76.3 bits (186), Expect = 8e-12 Identities = 32/57 (56%), Positives = 39/57 (68%) Frame = +3 Query: 6 KCPYPECDKEFDRKADYVRHEDAVHLKRKRFKCQRCDARFPRKDTLQRHKGDGCPKR 176 +C +P C K F RK D RHE VH K+K FKC C++ F RKDTL+RH+ DGC KR Sbjct: 256 QCSHPTCGKSFVRKTDKERHETCVHSKKKEFKCHLCNSMFARKDTLRRHEDDGCAKR 312