BLASTX nr result
ID: Cinnamomum23_contig00053071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00053071 (313 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM84354.1| hypothetical protein ANO11243_023480 [fungal sp.... 57 4e-06 gb|KKY27231.1| putative pheromone-regulated membrane protein 6 [... 57 5e-06 >dbj|GAM84354.1| hypothetical protein ANO11243_023480 [fungal sp. No.11243] Length = 651 Score = 57.4 bits (137), Expect = 4e-06 Identities = 34/74 (45%), Positives = 41/74 (55%) Frame = -1 Query: 304 PPYGSRPGTAQSNMRTGLVRQGTLPSIAPSPVGPRLQRQGTGLSVQTYSSNASLLHNAGD 125 PPY SR T+Q GL RQ TLP + + P R + +Y SNA LL N+G+ Sbjct: 347 PPYTSRAPTSQEPF--GLQRQPTLPDV--DSISPHRARPPMRQNNYSYGSNAPLLDNSGE 402 Query: 124 MGYDSDADSPMYGP 83 MGYDS SPM GP Sbjct: 403 MGYDSRPQSPMGGP 416 >gb|KKY27231.1| putative pheromone-regulated membrane protein 6 [Phaeomoniella chlamydospora] Length = 436 Score = 57.0 bits (136), Expect = 5e-06 Identities = 37/81 (45%), Positives = 44/81 (54%), Gaps = 2/81 (2%) Frame = -1 Query: 304 PPYGSRPGTAQSNMRTGLVRQGTLPSIAPSPVGP-RLQRQGTGLSVQTYSSNASLLHNAG 128 PPY S PG+ SN GL R T+P + P P R Q T S +YSSNA L+ +AG Sbjct: 341 PPYQSEPGSV-SNFDLGLERTPTMPEMPGRPGIPTRTATQATTASNVSYSSNAPLMSSAG 399 Query: 127 DMGYDSDADSPMYGPRA-GSP 68 DMGY SP GP G+P Sbjct: 400 DMGYGGRPSSPGPGPMGYGAP 420