BLASTX nr result
ID: Cinnamomum23_contig00052945
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00052945 (471 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIX98370.1| hypothetical protein Z520_05671 [Fonsecaea multim... 57 4e-06 >gb|KIX98370.1| hypothetical protein Z520_05671 [Fonsecaea multimorphosa CBS 102226] Length = 284 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -2 Query: 293 DDYDDNSSGRKSKGDSTMGKLMEKAGQTFGNEKMAQKGLDKREEA 159 D+YDDN+SG K K DSTMGK+MEKAG FG+ K+ ++G +KR A Sbjct: 235 DNYDDNTSGGK-KNDSTMGKVMEKAGSMFGSSKLEERGTEKRRGA 278