BLASTX nr result
ID: Cinnamomum23_contig00052936
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00052936 (257 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJX92616.1| ATP synthase gamma chain like protein [Zymoseptor... 61 3e-07 ref|XP_007930422.1| hypothetical protein MYCFIDRAFT_87963 [Pseud... 61 3e-07 ref|XP_003852292.1| hypothetical protein MYCGRDRAFT_80934 [Zymos... 61 3e-07 gb|KIV99522.1| ATP synthase F1, gamma subunit [Verruconis gallop... 60 7e-07 ref|XP_008720430.1| ATP synthase F1, gamma subunit [Cyphellophor... 58 2e-06 ref|XP_007677382.1| hypothetical protein BAUCODRAFT_34986 [Baudo... 58 2e-06 gb|AAX07697.1| ATP synthase gamma chain-like protein [Magnaporth... 57 5e-06 ref|XP_003710014.1| ATP synthase subunit gamma [Magnaporthe oryz... 57 5e-06 gb|KIW41849.1| ATP synthase F1, gamma subunit [Exophiala oligosp... 57 6e-06 dbj|GAM85990.1| hypothetical protein ANO11243_040000 [fungal sp.... 56 8e-06 gb|EMF13741.1| ATP synthase subunit gamma [Sphaerulina musiva SO... 56 8e-06 >gb|KJX92616.1| ATP synthase gamma chain like protein [Zymoseptoria brevis] Length = 303 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 162 LQTANYATLKEIEGRLKSIKNIEKITKTMKIV 257 LQ+ANYATL+EIEGRLKSIKNIEKITKTMKIV Sbjct: 26 LQSANYATLREIEGRLKSIKNIEKITKTMKIV 57 >ref|XP_007930422.1| hypothetical protein MYCFIDRAFT_87963 [Pseudocercospora fijiensis CIRAD86] gi|452980031|gb|EME79793.1| hypothetical protein MYCFIDRAFT_87963 [Pseudocercospora fijiensis CIRAD86] Length = 305 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 162 LQTANYATLKEIEGRLKSIKNIEKITKTMKIV 257 LQ+ANYATL+EIEGRLKSIKNIEKITKTMKIV Sbjct: 28 LQSANYATLREIEGRLKSIKNIEKITKTMKIV 59 >ref|XP_003852292.1| hypothetical protein MYCGRDRAFT_80934 [Zymoseptoria tritici IPO323] gi|339472173|gb|EGP87268.1| hypothetical protein MYCGRDRAFT_80934 [Zymoseptoria tritici IPO323] Length = 303 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 162 LQTANYATLKEIEGRLKSIKNIEKITKTMKIV 257 LQ+ANYATL+EIEGRLKSIKNIEKITKTMKIV Sbjct: 26 LQSANYATLREIEGRLKSIKNIEKITKTMKIV 57 >gb|KIV99522.1| ATP synthase F1, gamma subunit [Verruconis gallopava] Length = 299 Score = 59.7 bits (143), Expect = 7e-07 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +3 Query: 162 LQTANYATLKEIEGRLKSIKNIEKITKTMKIV 257 +Q+ANYATLKEIEGRLKSI+NIEKITKTMKIV Sbjct: 23 VQSANYATLKEIEGRLKSIRNIEKITKTMKIV 54 >ref|XP_008720430.1| ATP synthase F1, gamma subunit [Cyphellophora europaea CBS 101466] gi|568114276|gb|ETN36898.1| ATP synthase F1, gamma subunit [Cyphellophora europaea CBS 101466] Length = 297 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 165 QTANYATLKEIEGRLKSIKNIEKITKTMKIV 257 Q+ANYATL+EIEGRLKSI+NIEKITKTMKIV Sbjct: 24 QSANYATLREIEGRLKSIRNIEKITKTMKIV 54 >ref|XP_007677382.1| hypothetical protein BAUCODRAFT_34986 [Baudoinia compniacensis UAMH 10762] gi|449298972|gb|EMC94986.1| hypothetical protein BAUCODRAFT_34986 [Baudoinia compniacensis UAMH 10762] Length = 304 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 165 QTANYATLKEIEGRLKSIKNIEKITKTMKIV 257 QTANY TL+EIEGRLKSI+NIEKITKTMKIV Sbjct: 31 QTANYVTLREIEGRLKSIRNIEKITKTMKIV 61 >gb|AAX07697.1| ATP synthase gamma chain-like protein [Magnaporthe grisea] Length = 302 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 171 ANYATLKEIEGRLKSIKNIEKITKTMKIV 257 ANYATL+EIEGRLKSIKNIEKITKTMKIV Sbjct: 28 ANYATLREIEGRLKSIKNIEKITKTMKIV 56 >ref|XP_003710014.1| ATP synthase subunit gamma [Magnaporthe oryzae 70-15] gi|351649543|gb|EHA57402.1| ATP synthase subunit gamma [Magnaporthe oryzae 70-15] gi|440474838|gb|ELQ43558.1| ATP synthase gamma chain [Magnaporthe oryzae Y34] gi|440480417|gb|ELQ61079.1| ATP synthase gamma chain [Magnaporthe oryzae P131] Length = 302 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 171 ANYATLKEIEGRLKSIKNIEKITKTMKIV 257 ANYATL+EIEGRLKSIKNIEKITKTMKIV Sbjct: 28 ANYATLREIEGRLKSIKNIEKITKTMKIV 56 >gb|KIW41849.1| ATP synthase F1, gamma subunit [Exophiala oligosperma] Length = 297 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 165 QTANYATLKEIEGRLKSIKNIEKITKTMKIV 257 Q A YATL+EIEGRLKSIKNIEKITKTMKIV Sbjct: 24 QAAGYATLREIEGRLKSIKNIEKITKTMKIV 54 >dbj|GAM85990.1| hypothetical protein ANO11243_040000 [fungal sp. No.11243] Length = 304 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 162 LQTANYATLKEIEGRLKSIKNIEKITKTMKIV 257 + ANYATL+EIEGRLKSI+NIEKITKTMKIV Sbjct: 25 VNAANYATLREIEGRLKSIRNIEKITKTMKIV 56 >gb|EMF13741.1| ATP synthase subunit gamma [Sphaerulina musiva SO2202] Length = 305 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 162 LQTANYATLKEIEGRLKSIKNIEKITKTMKIV 257 LQ ANYATL++IE RLKS+KNIEKITKTMKIV Sbjct: 28 LQAANYATLRQIESRLKSLKNIEKITKTMKIV 59