BLASTX nr result
ID: Cinnamomum23_contig00052611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00052611 (287 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007747463.1| ADP-ribosylation factor [Cladophialophora ps... 130 4e-28 ref|XP_007758701.1| ADP-ribosylation factor [Cladophialophora ye... 130 4e-28 gb|KKY23929.1| putative adp-ribosylation factor [Phaeomoniella c... 129 1e-27 gb|KIX04641.1| ADP-ribosylation factor [Rhinocladiella mackenzie... 129 1e-27 ref|XP_007725373.1| ADP-ribosylation factor [Capronia coronata C... 129 1e-27 ref|XP_007920061.1| hypothetical protein MYCFIDRAFT_49010 [Pseud... 129 1e-27 ref|XP_007672425.1| hypothetical protein BAUCODRAFT_61772 [Baudo... 129 1e-27 ref|XP_001797240.1| hypothetical protein SNOG_06879 [Phaeosphaer... 129 1e-27 dbj|GAM83579.1| hypothetical protein ANO11243_015670 [fungal sp.... 128 1e-27 gb|KEQ60941.1| ARF/SAR superfamily [Aureobasidium melanogenum CB... 128 1e-27 ref|XP_007692073.1| hypothetical protein COCMIDRAFT_106246 [Bipo... 128 1e-27 ref|XP_003856771.1| hypothetical protein MYCGRDRAFT_102943 [Zymo... 128 1e-27 gb|EWG37568.1| ADP-ribosylation factor [Fusarium verticillioides... 126 6e-27 gb|KKF95343.1| ADP-ribosylation factor [Ceratocystis platani] 126 6e-27 gb|KIL95193.1| adp-ribosylation factor [Fusarium avenaceum] 126 6e-27 ref|XP_003054231.1| predicted protein [Nectria haematococca mpVI... 126 6e-27 ref|XP_007828274.1| ADP-ribosylation factor [Pestalotiopsis fici... 125 1e-26 ref|XP_008086386.1| P-loop containing nucleoside triphosphate hy... 125 1e-26 gb|KIW06748.1| ADP-ribosylation factor [Verruconis gallopava] gi... 125 1e-26 ref|XP_007293765.1| ADP-ribosylation factor 1 [Marssonina brunne... 125 1e-26 >ref|XP_007747463.1| ADP-ribosylation factor [Cladophialophora psammophila CBS 110553] gi|589985031|gb|EXJ68077.1| ADP-ribosylation factor [Cladophialophora psammophila CBS 110553] gi|759255469|gb|KIW32132.1| ADP-ribosylation factor [Cladophialophora immunda] gi|759309188|gb|KIW85590.1| ADP-ribosylation factor [Fonsecaea pedrosoi CBS 271.37] gi|759319037|gb|KIW95383.1| ADP-ribosylation factor [Cladophialophora bantiana CBS 173.52] gi|761334026|gb|KIX95616.1| ADP-ribosylation factor [Fonsecaea multimorphosa CBS 102226] Length = 183 Score = 130 bits (326), Expect = 4e-28 Identities = 62/62 (100%), Positives = 62/62 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 181 Query: 181 HS 186 HS Sbjct: 182 HS 183 >ref|XP_007758701.1| ADP-ribosylation factor [Cladophialophora yegresii CBS 114405] gi|671176224|ref|XP_008728575.1| ADP-ribosylation factor [Cladophialophora carrionii CBS 160.54] gi|565932692|gb|ETI21958.1| ADP-ribosylation factor [Cladophialophora carrionii CBS 160.54] gi|589975777|gb|EXJ59078.1| ADP-ribosylation factor [Cladophialophora yegresii CBS 114405] gi|759291262|gb|KIW67680.1| ADP-ribosylation factor [Capronia semiimmersa] Length = 183 Score = 130 bits (326), Expect = 4e-28 Identities = 62/62 (100%), Positives = 62/62 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 181 Query: 181 HS 186 HS Sbjct: 182 HS 183 >gb|KKY23929.1| putative adp-ribosylation factor [Phaeomoniella chlamydospora] Length = 183 Score = 129 bits (323), Expect = 1e-27 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 181 Query: 181 HS 186 H+ Sbjct: 182 HN 183 >gb|KIX04641.1| ADP-ribosylation factor [Rhinocladiella mackenziei CBS 650.93] Length = 183 Score = 129 bits (323), Expect = 1e-27 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 181 Query: 181 HS 186 H+ Sbjct: 182 HN 183 >ref|XP_007725373.1| ADP-ribosylation factor [Capronia coronata CBS 617.96] gi|590010730|gb|EXJ85935.1| ADP-ribosylation factor [Capronia coronata CBS 617.96] gi|759241836|gb|KIW18777.1| ADP-ribosylation factor [Exophiala spinifera] gi|759269947|gb|KIW46466.1| ADP-ribosylation factor [Exophiala oligosperma] gi|759269948|gb|KIW46467.1| ADP-ribosylation factor, variant [Exophiala oligosperma] Length = 183 Score = 129 bits (323), Expect = 1e-27 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 181 Query: 181 HS 186 H+ Sbjct: 182 HN 183 >ref|XP_007920061.1| hypothetical protein MYCFIDRAFT_49010 [Pseudocercospora fijiensis CIRAD86] gi|452847618|gb|EME49550.1| hypothetical protein DOTSEDRAFT_143649 [Dothistroma septosporum NZE10] gi|452989650|gb|EME89405.1| hypothetical protein MYCFIDRAFT_49010 [Pseudocercospora fijiensis CIRAD86] gi|453089149|gb|EMF17189.1| ARF/SAR superfamily [Sphaerulina musiva SO2202] gi|656910549|gb|KEF56208.1| ADP-ribosylation factor [Exophiala aquamarina CBS 119918] gi|759211501|gb|KIV88843.1| ADP-ribosylation factor [Exophiala mesophila] Length = 183 Score = 129 bits (323), Expect = 1e-27 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 181 Query: 181 HS 186 H+ Sbjct: 182 HN 183 >ref|XP_007672425.1| hypothetical protein BAUCODRAFT_61772 [Baudoinia compniacensis UAMH 10762] gi|628300876|ref|XP_007734003.1| ADP-ribosylation factor [Capronia epimyces CBS 606.96] gi|671143056|ref|XP_008711040.1| ADP-ribosylation factor [Cyphellophora europaea CBS 101466] gi|684164165|ref|XP_009155958.1| ADP-ribosylation factor [Exophiala dermatitidis NIH/UT8656] gi|378729038|gb|EHY55497.1| ADP-ribosylation factor [Exophiala dermatitidis NIH/UT8656] gi|449305234|gb|EMD01241.1| hypothetical protein BAUCODRAFT_61772 [Baudoinia compniacensis UAMH 10762] gi|568123743|gb|ETN46328.1| ADP-ribosylation factor [Cyphellophora europaea CBS 101466] gi|590009812|gb|EXJ85018.1| ADP-ribosylation factor [Capronia epimyces CBS 606.96] gi|759201996|gb|KIV79416.1| ADP-ribosylation factor [Exophiala sideris] gi|759276282|gb|KIW52789.1| ADP-ribosylation factor [Exophiala xenobiotica] Length = 183 Score = 129 bits (323), Expect = 1e-27 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 181 Query: 181 HS 186 H+ Sbjct: 182 HN 183 >ref|XP_001797240.1| hypothetical protein SNOG_06879 [Phaeosphaeria nodorum SN15] gi|189189756|ref|XP_001931217.1| ADP-ribosylation factor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330941983|ref|XP_003306107.1| hypothetical protein PTT_19141 [Pyrenophora teres f. teres 0-1] gi|396462996|ref|XP_003836109.1| similar to ADP-ribosylation factor [Leptosphaeria maculans JN3] gi|615420276|ref|XP_007586441.1| putative adp-ribosylation factor protein [Neofusicoccum parvum UCRNP2] gi|667837201|ref|XP_007782769.1| ADP-ribosylation factor [Coniosporium apollinis CBS 100218] gi|111064410|gb|EAT85530.1| hypothetical protein SNOG_06879 [Phaeosphaeria nodorum SN15] gi|187972823|gb|EDU40322.1| ADP-ribosylation factor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311316547|gb|EFQ85784.1| hypothetical protein PTT_19141 [Pyrenophora teres f. teres 0-1] gi|312212661|emb|CBX92744.1| similar to ADP-ribosylation factor [Leptosphaeria maculans JN3] gi|407918010|gb|EKG11308.1| Ras small GTPase Rab type [Macrophomina phaseolina MS6] gi|485919893|gb|EOD46072.1| putative adp-ribosylation factor protein [Neofusicoccum parvum UCRNP2] gi|494830941|gb|EON67452.1| ADP-ribosylation factor [Coniosporium apollinis CBS 100218] gi|821063163|gb|KKY18488.1| putative adp-ribosylation factor [Diplodia seriata] Length = 183 Score = 129 bits (323), Expect = 1e-27 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 181 Query: 181 HS 186 H+ Sbjct: 182 HN 183 >dbj|GAM83579.1| hypothetical protein ANO11243_015670 [fungal sp. No.11243] Length = 183 Score = 128 bits (322), Expect = 1e-27 Identities = 61/61 (100%), Positives = 61/61 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 181 Query: 181 H 183 H Sbjct: 182 H 182 >gb|KEQ60941.1| ARF/SAR superfamily [Aureobasidium melanogenum CBS 110374] gi|662516196|gb|KEQ73760.1| ARF/SAR superfamily [Aureobasidium namibiae CBS 147.97] gi|662527187|gb|KEQ84567.1| ARF/SAR superfamily [Aureobasidium pullulans EXF-150] gi|662537023|gb|KEQ94333.1| hypothetical protein AUEXF2481DRAFT_5826 [Aureobasidium subglaciale EXF-2481] Length = 183 Score = 128 bits (322), Expect = 1e-27 Identities = 61/61 (100%), Positives = 61/61 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 181 Query: 181 H 183 H Sbjct: 182 H 182 >ref|XP_007692073.1| hypothetical protein COCMIDRAFT_106246 [Bipolaris oryzae ATCC 44560] gi|628082288|ref|XP_007702994.1| hypothetical protein COCSADRAFT_96837 [Bipolaris sorokiniana ND90Pr] gi|628209183|ref|XP_007712825.1| hypothetical protein COCCADRAFT_97497 [Bipolaris zeicola 26-R-13] gi|636597383|ref|XP_008030030.1| hypothetical protein SETTUDRAFT_23174 [Setosphaeria turcica Et28A] gi|451848414|gb|EMD61720.1| hypothetical protein COCSADRAFT_96837 [Bipolaris sorokiniana ND90Pr] gi|451998936|gb|EMD91399.1| hypothetical protein COCHEDRAFT_1135886 [Bipolaris maydis C5] gi|477591772|gb|ENI08844.1| hypothetical protein COCC4DRAFT_129356 [Bipolaris maydis ATCC 48331] gi|482804815|gb|EOA81914.1| hypothetical protein SETTUDRAFT_23174 [Setosphaeria turcica Et28A] gi|576918708|gb|EUC32898.1| hypothetical protein COCCADRAFT_97497 [Bipolaris zeicola 26-R-13] gi|576927733|gb|EUC41405.1| hypothetical protein COCMIDRAFT_106246 [Bipolaris oryzae ATCC 44560] gi|578490700|gb|EUN28113.1| hypothetical protein COCVIDRAFT_96243 [Bipolaris victoriae FI3] Length = 183 Score = 128 bits (322), Expect = 1e-27 Identities = 61/61 (100%), Positives = 61/61 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 181 Query: 181 H 183 H Sbjct: 182 H 182 >ref|XP_003856771.1| hypothetical protein MYCGRDRAFT_102943 [Zymoseptoria tritici IPO323] gi|339476656|gb|EGP91747.1| hypothetical protein MYCGRDRAFT_102943 [Zymoseptoria tritici IPO323] gi|796696848|gb|KJX95507.1| adp-ribosylation factor like protein [Zymoseptoria brevis] Length = 183 Score = 128 bits (322), Expect = 1e-27 Identities = 61/61 (100%), Positives = 61/61 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 181 Query: 181 H 183 H Sbjct: 182 H 182 >gb|EWG37568.1| ADP-ribosylation factor [Fusarium verticillioides 7600] Length = 142 Score = 126 bits (316), Expect = 6e-27 Identities = 59/61 (96%), Positives = 61/61 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWL+N+LRKAG Sbjct: 81 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLANTLRKAG 140 Query: 181 H 183 H Sbjct: 141 H 141 >gb|KKF95343.1| ADP-ribosylation factor [Ceratocystis platani] Length = 183 Score = 126 bits (316), Expect = 6e-27 Identities = 59/61 (96%), Positives = 61/61 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWL+N+LRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLANTLRKAG 181 Query: 181 H 183 H Sbjct: 182 H 182 >gb|KIL95193.1| adp-ribosylation factor [Fusarium avenaceum] Length = 183 Score = 126 bits (316), Expect = 6e-27 Identities = 59/61 (96%), Positives = 61/61 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWL+N+LRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLANTLRKAG 181 Query: 181 H 183 H Sbjct: 182 H 182 >ref|XP_003054231.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|685865911|ref|XP_009259988.1| hypothetical protein FPSE_08595 [Fusarium pseudograminearum CS3096] gi|758188773|ref|XP_011316767.1| hypothetical protein FGSG_01014 [Fusarium graminearum PH-1] gi|256735172|gb|EEU48518.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|342887872|gb|EGU87300.1| hypothetical protein FOXB_02176 [Fusarium oxysporum Fo5176] gi|408391865|gb|EKJ71232.1| hypothetical protein FPSE_08595 [Fusarium pseudograminearum CS3096] gi|475664297|gb|EMT62092.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. cubense race 4] gi|477507571|gb|ENH60865.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. cubense race 1] gi|517310870|emb|CCT62268.1| probable ADP-ribosylation factor [Fusarium fujikuroi IMI 58289] gi|558856199|gb|ESU06282.1| hypothetical protein FGSG_01014 [Fusarium graminearum PH-1] gi|584128146|gb|EWG37565.1| ADP-ribosylation factor [Fusarium verticillioides 7600] gi|584128147|gb|EWG37566.1| ADP-ribosylation factor [Fusarium verticillioides 7600] gi|584128148|gb|EWG37567.1| ADP-ribosylation factor [Fusarium verticillioides 7600] gi|587671742|gb|EWY94083.1| ADP-ribosylation factor [Fusarium oxysporum FOSC 3-a] gi|587671743|gb|EWY94084.1| ADP-ribosylation factor [Fusarium oxysporum FOSC 3-a] gi|587704019|gb|EWZ50624.1| ADP-ribosylation factor [Fusarium oxysporum Fo47] gi|587704020|gb|EWZ50625.1| ADP-ribosylation factor [Fusarium oxysporum Fo47] gi|587720577|gb|EWZ91914.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. lycopersici MN25] gi|587755456|gb|EXA53172.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. pisi HDV247] gi|587755457|gb|EXA53173.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. pisi HDV247] gi|590046002|gb|EXK47860.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. melonis 26406] gi|590046003|gb|EXK47861.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. melonis 26406] gi|590062216|gb|EXK89740.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. raphani 54005] gi|590062217|gb|EXK89741.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. raphani 54005] gi|591414407|gb|EXL49544.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591414408|gb|EXL49545.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591448359|gb|EXL80769.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591448360|gb|EXL80770.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591479967|gb|EXM11027.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591479968|gb|EXM11028.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591494735|gb|EXM24283.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. vasinfectum 25433] gi|591494736|gb|EXM24284.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. vasinfectum 25433] gi|596554618|gb|EYB33707.1| hypothetical protein FG05_01014 [Fusarium graminearum] gi|699042087|emb|CEF73074.1| unnamed protein product [Fusarium graminearum] gi|829110882|gb|KLO87398.1| putative ADP-ribosylation factor [Fusarium fujikuroi] gi|829130508|gb|KLP04957.1| putative ADP-ribosylation factor [Fusarium fujikuroi] gi|829135142|gb|KLP08791.1| putative ADP-ribosylation factor [Fusarium fujikuroi] Length = 183 Score = 126 bits (316), Expect = 6e-27 Identities = 59/61 (96%), Positives = 61/61 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWL+N+LRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLANTLRKAG 181 Query: 181 H 183 H Sbjct: 182 H 182 >ref|XP_007828274.1| ADP-ribosylation factor [Pestalotiopsis fici W106-1] gi|573068146|gb|ETS87674.1| ADP-ribosylation factor [Pestalotiopsis fici W106-1] Length = 183 Score = 125 bits (314), Expect = 1e-26 Identities = 59/62 (95%), Positives = 61/62 (98%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWL+ +LRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLATTLRKAG 181 Query: 181 HS 186 HS Sbjct: 182 HS 183 >ref|XP_008086386.1| P-loop containing nucleoside triphosphate hydrolase [Glarea lozoyensis ATCC 20868] gi|512198361|gb|EPE27196.1| P-loop containing nucleoside triphosphate hydrolase [Glarea lozoyensis ATCC 20868] gi|751753822|gb|KIN02000.1| hypothetical protein OIDMADRAFT_18772 [Oidiodendron maius Zn] Length = 183 Score = 125 bits (314), Expect = 1e-26 Identities = 59/61 (96%), Positives = 61/61 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWL++SLRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLASSLRKAG 181 Query: 181 H 183 H Sbjct: 182 H 182 >gb|KIW06748.1| ADP-ribosylation factor [Verruconis gallopava] gi|759229773|gb|KIW06749.1| ADP-ribosylation factor, variant [Verruconis gallopava] Length = 183 Score = 125 bits (313), Expect = 1e-26 Identities = 57/62 (91%), Positives = 62/62 (100%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAE+TDKLGLHSLRQRAWYIQSTCAT+GDGLYEGLEWL+N+L+KAG Sbjct: 122 LVFANKQDLPNAMNAAEVTDKLGLHSLRQRAWYIQSTCATTGDGLYEGLEWLANALKKAG 181 Query: 181 HS 186 HS Sbjct: 182 HS 183 >ref|XP_007293765.1| ADP-ribosylation factor 1 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406862816|gb|EKD15865.1| ADP-ribosylation factor 1 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 183 Score = 125 bits (313), Expect = 1e-26 Identities = 59/61 (96%), Positives = 60/61 (98%) Frame = +1 Query: 1 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAG 180 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWL+ SLRKAG Sbjct: 122 LVFANKQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLAQSLRKAG 181 Query: 181 H 183 H Sbjct: 182 H 182