BLASTX nr result
ID: Cinnamomum23_contig00052320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00052320 (281 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012089723.1| PREDICTED: alanine--glyoxylate aminotransfer... 58 2e-06 >ref|XP_012089723.1| PREDICTED: alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial-like [Jatropha curcas] gi|643706987|gb|KDP22797.1| hypothetical protein JCGZ_00384 [Jatropha curcas] Length = 477 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 3/41 (7%) Frame = -2 Query: 115 CFSQLPSQRA---DGDVNIPKMPPFDYTPPPYEGPSSAEIL 2 CFSQL A D D IPKMPPFDY+PPPY GPSS EI+ Sbjct: 21 CFSQLAQNEASVLDNDALIPKMPPFDYSPPPYTGPSSEEIM 61