BLASTX nr result
ID: Cinnamomum23_contig00052185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00052185 (358 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007673458.1| hypothetical protein BAUCODRAFT_22547 [Baudo... 60 7e-07 dbj|GAM85881.1| hypothetical protein ANO11243_038910 [fungal sp.... 59 1e-06 >ref|XP_007673458.1| hypothetical protein BAUCODRAFT_22547 [Baudoinia compniacensis UAMH 10762] gi|449303285|gb|EMC99293.1| hypothetical protein BAUCODRAFT_22547 [Baudoinia compniacensis UAMH 10762] Length = 159 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 270 GGQPAMAPFLTNFNLVAEAAKRAQMACLMRDLGDVEL 160 GG P AP+L +FNLVAEAAKRAQMACL RDLGD+ L Sbjct: 123 GGAPETAPYLQDFNLVAEAAKRAQMACLTRDLGDIGL 159 >dbj|GAM85881.1| hypothetical protein ANO11243_038910 [fungal sp. No.11243] Length = 165 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = -2 Query: 285 ADASRGGQPAMAPFLTNFNLVAEAAKRAQMACLMRDLGDVEL 160 A A+ G P A FL N NLVAEAAKRAQMACLMRDL +VEL Sbjct: 124 AGAAAQGSPETASFLNNLNLVAEAAKRAQMACLMRDLSEVEL 165