BLASTX nr result
ID: Cinnamomum23_contig00052025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00052025 (278 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJK64246.1| Subunit 21 of Mediator complex [Aspergillus paras... 59 2e-06 ref|XP_002378474.1| conserved hypothetical protein [Aspergillus ... 59 2e-06 ref|XP_001823138.1| hypothetical protein AOR_1_502114 [Aspergill... 59 2e-06 gb|KJJ29146.1| Subunit 21 of Mediator complex [Aspergillus flavu... 58 2e-06 ref|XP_001259972.1| hypothetical protein NFIA_080170 [Neosartory... 56 8e-06 >gb|KJK64246.1| Subunit 21 of Mediator complex [Aspergillus parasiticus SU-1] Length = 861 Score = 58.5 bits (140), Expect = 2e-06 Identities = 38/103 (36%), Positives = 55/103 (53%), Gaps = 12/103 (11%) Frame = -2 Query: 274 GTGTINESYFVVQTGGGTIPYAAVLSQAEEKVPNSSAE------------APNPFDKGYH 131 GTG+ ES++VV T GGT+ YA +LS+AE++ SS E P+P Sbjct: 596 GTGSTAESFYVVPTTGGTVSYAGILSRAEKEARRSSFEEGDEDFVDARETPPSP------ 649 Query: 130 SKFEGHSGLQGAKMRPAASLKSSPTNKRVEELQVENESLKQLT 2 + +G +G R L S + K +EELQ+EN++LK LT Sbjct: 650 EMRQSMTGSKGRGSRGKDKLTSIQSPKTLEELQMENQALKHLT 692 >ref|XP_002378474.1| conserved hypothetical protein [Aspergillus flavus NRRL3357] gi|220695124|gb|EED51467.1| conserved hypothetical protein [Aspergillus flavus NRRL3357] Length = 577 Score = 58.5 bits (140), Expect = 2e-06 Identities = 38/103 (36%), Positives = 55/103 (53%), Gaps = 12/103 (11%) Frame = -2 Query: 274 GTGTINESYFVVQTGGGTIPYAAVLSQAEEKVPNSSAE------------APNPFDKGYH 131 GTG+ ES++VV T GGT+ YA +LS+AE++ SS E P+P Sbjct: 312 GTGSTAESFYVVPTTGGTVSYAGILSRAEKEARRSSFEEGDEDFVDARETPPSP------ 365 Query: 130 SKFEGHSGLQGAKMRPAASLKSSPTNKRVEELQVENESLKQLT 2 + +G +G R L S + K +EELQ+EN++LK LT Sbjct: 366 EMRQSMTGSKGRGSRGKDKLTSIQSPKTLEELQMENQALKHLT 408 >ref|XP_001823138.1| hypothetical protein AOR_1_502114 [Aspergillus oryzae RIB40] gi|83771875|dbj|BAE62005.1| unnamed protein product [Aspergillus oryzae RIB40] gi|391871308|gb|EIT80468.1| hypothetical protein Ao3042_02875 [Aspergillus oryzae 3.042] gi|635508943|gb|KDE80918.1| hypothetical protein AO1008_07276 [Aspergillus oryzae 100-8] Length = 569 Score = 58.5 bits (140), Expect = 2e-06 Identities = 38/103 (36%), Positives = 55/103 (53%), Gaps = 12/103 (11%) Frame = -2 Query: 274 GTGTINESYFVVQTGGGTIPYAAVLSQAEEKVPNSSAE------------APNPFDKGYH 131 GTG+ ES++VV T GGT+ YA +LS+AE++ SS E P+P Sbjct: 304 GTGSTAESFYVVPTTGGTVSYAGILSRAEKEARRSSFEEGDEDFVDARETPPSP------ 357 Query: 130 SKFEGHSGLQGAKMRPAASLKSSPTNKRVEELQVENESLKQLT 2 + +G +G R L S + K +EELQ+EN++LK LT Sbjct: 358 EMRQSMTGSKGRGSRGKDKLTSIQSPKTLEELQMENQALKHLT 400 >gb|KJJ29146.1| Subunit 21 of Mediator complex [Aspergillus flavus AF70] Length = 887 Score = 58.2 bits (139), Expect = 2e-06 Identities = 38/103 (36%), Positives = 55/103 (53%), Gaps = 12/103 (11%) Frame = -2 Query: 274 GTGTINESYFVVQTGGGTIPYAAVLSQAEEKVPNSSAE------------APNPFDKGYH 131 GTG+ ES++VV T GGT+ YA +LS+AE++ SS E P+P Sbjct: 622 GTGSTAESFYVVPTTGGTVSYAGILSRAEKEARRSSFEEGDEDFVDARETPPSP------ 675 Query: 130 SKFEGHSGLQGAKMRPAASLKSSPTNKRVEELQVENESLKQLT 2 + +G +G R L S + K +EELQ+EN++LK LT Sbjct: 676 ELRQSMTGSKGRGSRGKDKLTSIQSPKTLEELQMENQALKHLT 718 >ref|XP_001259972.1| hypothetical protein NFIA_080170 [Neosartorya fischeri NRRL 181] gi|119408126|gb|EAW18075.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181] Length = 581 Score = 56.2 bits (134), Expect = 8e-06 Identities = 36/97 (37%), Positives = 54/97 (55%), Gaps = 6/97 (6%) Frame = -2 Query: 274 GTGTINESYFVVQTGGGTIPYAAVLSQAEEKV-PNSSAEAPNPFDKGYHSKF-----EGH 113 G G ES++VV T GGT+ YA +L++AE++ NS EA + F + + Sbjct: 316 GAGNTAESFYVVPTTGGTVSYAGILTRAEKEARRNSLDEADDDFVDARETPASPELRQSL 375 Query: 112 SGLQGAKMRPAASLKSSPTNKRVEELQVENESLKQLT 2 +G +G R A L S K +EELQ+EN++LK L+ Sbjct: 376 TGSRGRASRAADKLTSLHNPKTMEELQMENQALKHLS 412