BLASTX nr result
ID: Cinnamomum23_contig00051003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00051003 (285 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010917354.1| PREDICTED: F-box/kelch-repeat protein At1g57... 59 1e-06 >ref|XP_010917354.1| PREDICTED: F-box/kelch-repeat protein At1g57790-like [Elaeis guineensis] Length = 411 Score = 59.3 bits (142), Expect = 1e-06 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 8/94 (8%) Frame = -1 Query: 285 GNLGVYNVIEDSWNVLKIPMPL------ELPRGHCFLMESKEELLLVYL--LRTEIHMFS 130 GNLGV+N + +W VL+ P P+ E C+L+ES ELL V+ I +F Sbjct: 265 GNLGVFNPRDMTWTVLERPKPIHSVVNEERRLEDCYLVESNGELLSVFNGNAAKPILVFR 324 Query: 129 LDESKMVWVEVEVLEDLTLFLSQSTSLAMIATKE 28 LD+SKM W +V+ L TLFL TSL++ A K+ Sbjct: 325 LDKSKMTWRKVDDLGKETLFLDVRTSLSVRAPKK 358