BLASTX nr result
ID: Cinnamomum23_contig00050864
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00050864 (452 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009599585.1| PREDICTED: uncharacterized protein LOC104095... 57 5e-06 gb|EMT16429.1| hypothetical protein F775_01472 [Aegilops tauschii] 57 6e-06 >ref|XP_009599585.1| PREDICTED: uncharacterized protein LOC104095213 [Nicotiana tomentosiformis] Length = 141 Score = 57.0 bits (136), Expect = 5e-06 Identities = 32/66 (48%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = +3 Query: 243 SLCPYLFALIMDRLMGDISNEVPRCMLLLDDVMLIIQIRR*ANIKSESWRWAL-SNSCQV 419 +L P+LFAL MD L I EVP CML DD++LI + RR N+K E WR L S ++ Sbjct: 19 ALSPFLFALAMDVLSQHIQGEVPWCMLFADDIVLIDETRRGVNVKLEVWRQTLESKGFKL 78 Query: 420 SINKPK 437 S K K Sbjct: 79 SRTKTK 84 >gb|EMT16429.1| hypothetical protein F775_01472 [Aegilops tauschii] Length = 571 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/55 (49%), Positives = 35/55 (63%) Frame = +3 Query: 243 SLCPYLFALIMDRLMGDISNEVPRCMLLLDDVMLIIQIRR*ANIKSESWRWALSN 407 +L PYLFAL+MD + DI ++P CML DDV+L+ R AN K E WR L + Sbjct: 249 ALSPYLFALVMDEVTRDIQGDIPWCMLFADDVVLVDDSRTGANRKLELWRQTLES 303