BLASTX nr result
ID: Cinnamomum23_contig00050585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00050585 (339 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIX06477.1| 40S ribosomal protein S9 [Rhinocladiella mackenzi... 135 1e-29 gb|KIW73335.1| 40S ribosomal protein S9 [Capronia semiimmersa] 135 1e-29 gb|KIW24305.1| 40S ribosomal protein S9 [Cladophialophora immunda] 135 1e-29 ref|XP_007724904.1| 40S ribosomal protein S9 [Capronia coronata ... 135 1e-29 ref|XP_007752813.1| 40S ribosomal protein S9 [Cladophialophora y... 135 1e-29 ref|XP_007750565.1| 40S ribosomal protein S9 [Cladophialophora p... 135 1e-29 ref|XP_008722253.1| 40S ribosomal protein S9 [Cladophialophora c... 135 1e-29 ref|XP_007587858.1| putative 40s ribosomal protein s9 protein [N... 135 1e-29 gb|EKG11582.1| Ribosomal protein S4/S9 [Macrophomina phaseolina ... 135 1e-29 ref|XP_009155008.1| 40S ribosomal protein S9 [Exophiala dermatit... 135 1e-29 gb|KIX95793.1| 40S ribosomal protein S9 [Fonsecaea multimorphosa... 134 2e-29 gb|KIW44874.1| 40S ribosomal protein S9 [Exophiala oligosperma] 134 2e-29 gb|KIW15420.1| 40S ribosomal protein S9 [Exophiala spinifera] 134 2e-29 gb|KIW07901.1| 40S ribosomal protein S9 [Verruconis gallopava] 134 2e-29 gb|KIV89206.1| 40S ribosomal protein S9 [Exophiala mesophila] 134 2e-29 gb|KIV80024.1| 40S ribosomal protein S9 [Exophiala sideris] 134 2e-29 dbj|GAM87141.1| hypothetical protein ANO11243_051620 [fungal sp.... 134 2e-29 ref|XP_008711137.1| 40S ribosomal protein S9 [Cyphellophora euro... 134 2e-29 emb|CEJ57154.1| Putative Ribosomal protein [Penicillium brasilia... 134 3e-29 gb|KIW78598.1| 40S ribosomal protein S9 [Fonsecaea pedrosoi CBS ... 134 3e-29 >gb|KIX06477.1| 40S ribosomal protein S9 [Rhinocladiella mackenziei CBS 650.93] Length = 193 Score = 135 bits (339), Expect = 1e-29 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH Sbjct: 94 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162 >gb|KIW73335.1| 40S ribosomal protein S9 [Capronia semiimmersa] Length = 193 Score = 135 bits (339), Expect = 1e-29 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH Sbjct: 94 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162 >gb|KIW24305.1| 40S ribosomal protein S9 [Cladophialophora immunda] Length = 193 Score = 135 bits (339), Expect = 1e-29 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH Sbjct: 94 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162 >ref|XP_007724904.1| 40S ribosomal protein S9 [Capronia coronata CBS 617.96] gi|590010261|gb|EXJ85466.1| 40S ribosomal protein S9 [Capronia coronata CBS 617.96] Length = 193 Score = 135 bits (339), Expect = 1e-29 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH Sbjct: 94 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162 >ref|XP_007752813.1| 40S ribosomal protein S9 [Cladophialophora yegresii CBS 114405] gi|589981005|gb|EXJ64246.1| 40S ribosomal protein S9 [Cladophialophora yegresii CBS 114405] Length = 196 Score = 135 bits (339), Expect = 1e-29 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH Sbjct: 97 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 156 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 157 IDFALTSPF 165 >ref|XP_007750565.1| 40S ribosomal protein S9 [Cladophialophora psammophila CBS 110553] gi|589978218|gb|EXJ61489.1| 40S ribosomal protein S9 [Cladophialophora psammophila CBS 110553] gi|759319470|gb|KIW95815.1| 40S ribosomal protein S9 [Cladophialophora bantiana CBS 173.52] Length = 192 Score = 135 bits (339), Expect = 1e-29 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH Sbjct: 94 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162 >ref|XP_008722253.1| 40S ribosomal protein S9 [Cladophialophora carrionii CBS 160.54] gi|565939073|gb|ETI28179.1| 40S ribosomal protein S9 [Cladophialophora carrionii CBS 160.54] Length = 193 Score = 135 bits (339), Expect = 1e-29 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH Sbjct: 94 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162 >ref|XP_007587858.1| putative 40s ribosomal protein s9 protein [Neofusicoccum parvum UCRNP2] gi|485917877|gb|EOD44674.1| putative 40s ribosomal protein s9 protein [Neofusicoccum parvum UCRNP2] gi|821074084|gb|KKY28979.1| putative 40s ribosomal protein s9 [Diplodia seriata] Length = 191 Score = 135 bits (339), Expect = 1e-29 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH Sbjct: 94 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162 >gb|EKG11582.1| Ribosomal protein S4/S9 [Macrophomina phaseolina MS6] Length = 191 Score = 135 bits (339), Expect = 1e-29 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH Sbjct: 94 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162 >ref|XP_009155008.1| 40S ribosomal protein S9 [Exophiala dermatitidis NIH/UT8656] gi|378728088|gb|EHY54547.1| 40S ribosomal protein S9 [Exophiala dermatitidis NIH/UT8656] Length = 193 Score = 135 bits (339), Expect = 1e-29 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH Sbjct: 94 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162 >gb|KIX95793.1| 40S ribosomal protein S9 [Fonsecaea multimorphosa CBS 102226] Length = 193 Score = 134 bits (338), Expect = 2e-29 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSF+VRLDSQKH Sbjct: 94 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFIVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162 >gb|KIW44874.1| 40S ribosomal protein S9 [Exophiala oligosperma] Length = 193 Score = 134 bits (338), Expect = 2e-29 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSF+VRLDSQKH Sbjct: 94 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFIVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162 >gb|KIW15420.1| 40S ribosomal protein S9 [Exophiala spinifera] Length = 193 Score = 134 bits (338), Expect = 2e-29 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSF+VRLDSQKH Sbjct: 94 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFIVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162 >gb|KIW07901.1| 40S ribosomal protein S9 [Verruconis gallopava] Length = 191 Score = 134 bits (338), Expect = 2e-29 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSF+VRLDSQKH Sbjct: 94 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFIVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162 >gb|KIV89206.1| 40S ribosomal protein S9 [Exophiala mesophila] Length = 193 Score = 134 bits (338), Expect = 2e-29 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSF+VRLDSQKH Sbjct: 94 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFIVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162 >gb|KIV80024.1| 40S ribosomal protein S9 [Exophiala sideris] Length = 193 Score = 134 bits (338), Expect = 2e-29 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSF+VRLDSQKH Sbjct: 94 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFIVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162 >dbj|GAM87141.1| hypothetical protein ANO11243_051620 [fungal sp. No.11243] Length = 192 Score = 134 bits (338), Expect = 2e-29 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSF+VRLDSQKH Sbjct: 94 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFIVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162 >ref|XP_008711137.1| 40S ribosomal protein S9 [Cyphellophora europaea CBS 101466] gi|568123840|gb|ETN46425.1| 40S ribosomal protein S9 [Cyphellophora europaea CBS 101466] Length = 195 Score = 134 bits (338), Expect = 2e-29 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSF+VRLDSQKH Sbjct: 94 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFIVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162 >emb|CEJ57154.1| Putative Ribosomal protein [Penicillium brasilianum] Length = 193 Score = 134 bits (336), Expect = 3e-29 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKVEDFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSF+VRLDSQKH Sbjct: 96 VLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFMVRLDSQKH 155 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 156 IDFALTSPF 164 >gb|KIW78598.1| 40S ribosomal protein S9 [Fonsecaea pedrosoi CBS 271.37] Length = 193 Score = 134 bits (336), Expect = 3e-29 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = -2 Query: 338 VLALKVEDFLGRRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 159 VLALKV+DFL RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH Sbjct: 94 VLALKVDDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKH 153 Query: 158 IDFALTSPF 132 IDFALTSPF Sbjct: 154 IDFALTSPF 162