BLASTX nr result
ID: Cinnamomum23_contig00050159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00050159 (721 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF01650.1| ATP synthase beta subunit [Sargentodoxa cuneata] 59 2e-06 gb|AIZ57536.1| ATP synthase CF1 beta subunit (chloroplast) [Clem... 59 3e-06 ref|YP_009073434.1| ATP synthase CF1 beta subunit [Thysanolaena ... 59 3e-06 gb|AGN73987.1| ATP synthase CF1 beta subunit (chloroplast) [Acon... 59 3e-06 gb|AHI90539.1| ATP synthase beta subunit, partial (chloroplast) ... 59 3e-06 ref|YP_009093957.1| ATP synthase CF1 beta subunit (chloroplast) ... 59 3e-06 gb|ACN66392.1| ATP synthase beta chain [Tinospora smilacina] 59 3e-06 gb|ACN66391.1| ATP synthase beta chain [Tinospora esiangkara] 59 3e-06 gb|ACN66389.1| ATP synthase beta chain [Tiliacora funifera] 59 3e-06 gb|ACN66387.1| ATP synthase beta chain [Strychnopsis thouarsii] 59 3e-06 gb|ACN66383.1| ATP synthase beta chain [Sinomenium acutum] 59 3e-06 gb|ACN66382.1| ATP synthase beta chain [Sciadotenia toxifera] 59 3e-06 gb|ACN66381.1| ATP synthase beta chain [Sarcopetalum harveyanum] 59 3e-06 gb|ACN66380.1| ATP synthase beta chain [Pycnarrhena celebica] 59 3e-06 gb|ACN66379.1| ATP synthase beta chain [Pycnarrhena celebica] 59 3e-06 gb|ACN66378.1| ATP synthase beta chain [Pericampylus glaucus] 59 3e-06 gb|ACN66376.1| ATP synthase beta chain [Penianthus longifolius] 59 3e-06 gb|ACN66375.1| ATP synthase beta chain [Parapachygone longifolia] 59 3e-06 gb|ACN66374.1| ATP synthase beta chain [Parabaena sagittata] 59 3e-06 gb|ACN66372.1| ATP synthase beta chain [Orthomene schomburgkii] 59 3e-06 >gb|AAF01650.1| ATP synthase beta subunit [Sargentodoxa cuneata] Length = 492 Score = 59.3 bits (142), Expect = 2e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 432 AEVFTGSPGKYVGLTETIRGFQLILSXELDGL 463 >gb|AIZ57536.1| ATP synthase CF1 beta subunit (chloroplast) [Clematis fusca var. coreana] Length = 500 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 440 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 471 >ref|YP_009073434.1| ATP synthase CF1 beta subunit [Thysanolaena latifolia] gi|686986531|gb|AIQ80043.1| ATP synthase CF1 beta subunit (plastid) [Thysanolaena latifolia] Length = 498 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 438 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 469 >gb|AGN73987.1| ATP synthase CF1 beta subunit (chloroplast) [Aconitum barbatum var. puberulum] Length = 498 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 438 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 469 >gb|AHI90539.1| ATP synthase beta subunit, partial (chloroplast) [Smilax riparia] Length = 494 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 434 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 465 >ref|YP_009093957.1| ATP synthase CF1 beta subunit (chloroplast) [Nelumbo nucifera] gi|224474229|gb|ACN49415.1| ATP synthase CF1 beta subunit (chloroplast) [Nelumbo nucifera] gi|290490156|gb|ADD31485.1| ATP synthase CF1 beta subunit protein (chloroplast) [Nelumbo nucifera] gi|383286804|gb|AFH01454.1| ATP synthase CF1 beta subunit (chloroplast) [Nelumbo nucifera] gi|519666919|gb|AGO98531.1| ATP synthase CF1 beta subunit (chloroplast) [Nelumbo nucifera] Length = 498 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 438 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 469 >gb|ACN66392.1| ATP synthase beta chain [Tinospora smilacina] Length = 471 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 426 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 457 >gb|ACN66391.1| ATP synthase beta chain [Tinospora esiangkara] Length = 489 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 432 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 463 >gb|ACN66389.1| ATP synthase beta chain [Tiliacora funifera] Length = 489 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 432 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 463 >gb|ACN66387.1| ATP synthase beta chain [Strychnopsis thouarsii] Length = 489 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 432 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 463 >gb|ACN66383.1| ATP synthase beta chain [Sinomenium acutum] Length = 471 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 426 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 457 >gb|ACN66382.1| ATP synthase beta chain [Sciadotenia toxifera] Length = 487 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 430 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 461 >gb|ACN66381.1| ATP synthase beta chain [Sarcopetalum harveyanum] Length = 469 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 412 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 443 >gb|ACN66380.1| ATP synthase beta chain [Pycnarrhena celebica] Length = 489 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 432 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 463 >gb|ACN66379.1| ATP synthase beta chain [Pycnarrhena celebica] Length = 489 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 432 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 463 >gb|ACN66378.1| ATP synthase beta chain [Pericampylus glaucus] Length = 489 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 432 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 463 >gb|ACN66376.1| ATP synthase beta chain [Penianthus longifolius] Length = 461 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 415 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 446 >gb|ACN66375.1| ATP synthase beta chain [Parapachygone longifolia] Length = 489 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 432 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 463 >gb|ACN66374.1| ATP synthase beta chain [Parabaena sagittata] Length = 489 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 432 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 463 >gb|ACN66372.1| ATP synthase beta chain [Orthomene schomburgkii] Length = 476 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 719 AEVFTGSPGKYVGLTETIREFQLILSRKLDGL 624 AEVFTGSPGKYVGLTETIR FQLILS +LDGL Sbjct: 419 AEVFTGSPGKYVGLTETIRGFQLILSGELDGL 450