BLASTX nr result
ID: Cinnamomum23_contig00049032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00049032 (340 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007037324.1| Pentatricopeptide repeat-containing protein,... 60 4e-07 ref|XP_010663367.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_002268980.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_008239957.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_007210651.1| hypothetical protein PRUPE_ppa019423mg, part... 57 4e-06 gb|KMT10840.1| hypothetical protein BVRB_5g114930 [Beta vulgaris... 57 5e-06 ref|XP_010678537.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 ref|XP_010939494.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-06 >ref|XP_007037324.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590667837|ref|XP_007037325.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508774569|gb|EOY21825.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508774570|gb|EOY21826.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 894 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 287 YPGAYVSLSNLCAAVGDWEEIFKI*CLMSSVGVRKEPGWSCV 162 + GAYVSLSN+CA +G WE + +I LM+ GVRKEPGWS V Sbjct: 853 HSGAYVSLSNICADIGQWEGVLEIRSLMNGTGVRKEPGWSSV 894 >ref|XP_010663367.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic isoform X2 [Vitis vinifera] Length = 861 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -3 Query: 281 GAYVSLSNLCAAVGDWEEIFKI*CLMSSVGVRKEPGWSCV 162 GAYV+LSN+CA +G WE++ KI LM GV+KEPGWS V Sbjct: 822 GAYVTLSNICADMGWWEDVMKIRSLMEGTGVKKEPGWSSV 861 >ref|XP_002268980.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic isoform X1 [Vitis vinifera] gi|731425761|ref|XP_010663366.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic isoform X1 [Vitis vinifera] gi|297733984|emb|CBI15231.3| unnamed protein product [Vitis vinifera] Length = 893 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -3 Query: 281 GAYVSLSNLCAAVGDWEEIFKI*CLMSSVGVRKEPGWSCV 162 GAYV+LSN+CA +G WE++ KI LM GV+KEPGWS V Sbjct: 854 GAYVTLSNICADMGWWEDVMKIRSLMEGTGVKKEPGWSSV 893 >ref|XP_008239957.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Prunus mume] Length = 885 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = -3 Query: 281 GAYVSLSNLCAAVGDWEEIFKI*CLMSSVGVRKEPGWSCV 162 G YVSLSN+CA VG WEE+ KI M VRKEPGWS V Sbjct: 846 GTYVSLSNICADVGQWEEVLKIRSQMKGTDVRKEPGWSLV 885 >ref|XP_007210651.1| hypothetical protein PRUPE_ppa019423mg, partial [Prunus persica] gi|462406386|gb|EMJ11850.1| hypothetical protein PRUPE_ppa019423mg, partial [Prunus persica] Length = 518 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/40 (62%), Positives = 28/40 (70%) Frame = -3 Query: 281 GAYVSLSNLCAAVGDWEEIFKI*CLMSSVGVRKEPGWSCV 162 G Y+SLSN+CA VG WEE+ KI M VRKEPGWS V Sbjct: 479 GTYISLSNICADVGQWEEVLKIRSQMKGTDVRKEPGWSLV 518 >gb|KMT10840.1| hypothetical protein BVRB_5g114930 [Beta vulgaris subsp. vulgaris] Length = 788 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = -3 Query: 284 PGAYVSLSNLCAAVGDWEEIFKI*CLMSSVGVRKEPGWSCV 162 PGAY+SLSNLCA +G WEE+ +I LM + KEPGWS V Sbjct: 748 PGAYISLSNLCADIGQWEEVEEIRDLMKGTTLSKEPGWSLV 788 >ref|XP_010678537.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Beta vulgaris subsp. vulgaris] Length = 896 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = -3 Query: 284 PGAYVSLSNLCAAVGDWEEIFKI*CLMSSVGVRKEPGWSCV 162 PGAY+SLSNLCA +G WEE+ +I LM + KEPGWS V Sbjct: 856 PGAYISLSNLCADIGQWEEVEEIRDLMKGTTLSKEPGWSLV 896 >ref|XP_010939494.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Elaeis guineensis] Length = 756 Score = 56.6 bits (135), Expect = 6e-06 Identities = 21/40 (52%), Positives = 31/40 (77%) Frame = -3 Query: 281 GAYVSLSNLCAAVGDWEEIFKI*CLMSSVGVRKEPGWSCV 162 G+Y+SLSN+ A +G+WEE+ +I C M G++KEPGWS + Sbjct: 717 GSYISLSNISAGMGEWEEVLRIRCSMKGGGIKKEPGWSII 756