BLASTX nr result
ID: Cinnamomum23_contig00048441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00048441 (244 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009379487.1| PREDICTED: G-type lectin S-receptor-like ser... 62 2e-07 ref|XP_010265967.1| PREDICTED: G-type lectin S-receptor-like ser... 60 4e-07 ref|XP_010265966.1| PREDICTED: LOW QUALITY PROTEIN: G-type lecti... 60 4e-07 ref|XP_008243678.1| PREDICTED: G-type lectin S-receptor-like ser... 59 1e-06 ref|XP_009376475.1| PREDICTED: G-type lectin S-receptor-like ser... 59 1e-06 ref|XP_008358889.1| PREDICTED: G-type lectin S-receptor-like ser... 59 2e-06 ref|XP_008349474.1| PREDICTED: G-type lectin S-receptor-like ser... 59 2e-06 ref|XP_010649413.1| PREDICTED: G-type lectin S-receptor-like ser... 57 4e-06 ref|XP_008366187.1| PREDICTED: G-type lectin S-receptor-like ser... 57 4e-06 ref|XP_008349473.1| PREDICTED: G-type lectin S-receptor-like ser... 57 4e-06 ref|XP_008380936.1| PREDICTED: G-type lectin S-receptor-like ser... 57 4e-06 gb|KHN27126.1| G-type lectin S-receptor-like serine/threonine-pr... 57 6e-06 ref|XP_003555643.1| PREDICTED: G-type lectin S-receptor-like ser... 57 6e-06 ref|XP_010087364.1| G-type lectin S-receptor-like serine/threoni... 56 8e-06 ref|XP_010044982.1| PREDICTED: G-type lectin S-receptor-like ser... 56 8e-06 ref|XP_012092618.1| PREDICTED: G-type lectin S-receptor-like ser... 56 8e-06 gb|KCW87121.1| hypothetical protein EUGRSUZ_B03649 [Eucalyptus g... 56 8e-06 ref|XP_004295222.1| PREDICTED: G-type lectin S-receptor-like ser... 56 8e-06 >ref|XP_009379487.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Pyrus x bretschneideri] Length = 776 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 113 NIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAY 6 ++YSFGI+LLEI+CCRKH E KM HE ++IL DWAY Sbjct: 669 DVYSFGILLLEIVCCRKHYEAKMEHEGQMILVDWAY 704 >ref|XP_010265967.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Nelumbo nucifera] Length = 805 Score = 60.5 bits (145), Expect = 4e-07 Identities = 24/37 (64%), Positives = 33/37 (89%) Frame = -3 Query: 116 LNIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAY 6 +++YS+G++LLEIICCRK +E++MG EEE IL DWAY Sbjct: 697 VDVYSYGVMLLEIICCRKSVELEMGSEEEAILTDWAY 733 >ref|XP_010265966.1| PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Nelumbo nucifera] Length = 787 Score = 60.5 bits (145), Expect = 4e-07 Identities = 24/37 (64%), Positives = 33/37 (89%) Frame = -3 Query: 116 LNIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAY 6 +++YS+G++LLEIICCRK +E++MG EEE IL DWAY Sbjct: 679 VDVYSYGVMLLEIICCRKSVELEMGSEEEAILTDWAY 715 >ref|XP_008243678.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Prunus mume] Length = 809 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/37 (64%), Positives = 33/37 (89%) Frame = -3 Query: 116 LNIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAY 6 +++YSFGI+LLEIICCRKH E K+ +E+++IL DWAY Sbjct: 694 VDVYSFGILLLEIICCRKHYEPKIENEDQMILADWAY 730 >ref|XP_009376475.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Pyrus x bretschneideri] Length = 800 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 113 NIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAY 6 ++YSFGI+LLEIICCRKH E M EE++IL DWAY Sbjct: 691 DVYSFGILLLEIICCRKHYEENMQDEEQMILADWAY 726 >ref|XP_008358889.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Malus domestica] Length = 770 Score = 58.5 bits (140), Expect = 2e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = -3 Query: 113 NIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAY 6 ++YSFGI+LLEI+CCRKH E K+ +E++IL DWAY Sbjct: 668 DVYSFGILLLEIVCCRKHYEAKIEEQEQMILVDWAY 703 >ref|XP_008349474.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Malus domestica] Length = 299 Score = 58.5 bits (140), Expect = 2e-06 Identities = 22/36 (61%), Positives = 31/36 (86%) Frame = -3 Query: 113 NIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAY 6 ++YSFG++LLEI+CCRKH E KM E++++L DWAY Sbjct: 190 DVYSFGVMLLEIVCCRKHYEPKMEDEDQMVLADWAY 225 >ref|XP_010649413.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 isoform X1 [Vitis vinifera] gi|731387891|ref|XP_010649414.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 isoform X2 [Vitis vinifera] Length = 796 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/37 (62%), Positives = 33/37 (89%) Frame = -3 Query: 113 NIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAYR 3 +IYS+GIVLLEI+CCRK+MEV++ + EE+IL +W Y+ Sbjct: 694 DIYSYGIVLLEIVCCRKNMEVQVKNPEEIILSNWVYQ 730 >ref|XP_008366187.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Malus domestica] Length = 1320 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = -3 Query: 113 NIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAY 6 ++YSFGI+LLEI+CCRK+ E KM E+++IL DWAY Sbjct: 612 DVYSFGILLLEIVCCRKNYEAKMEDEDQMILADWAY 647 >ref|XP_008349473.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Malus domestica] Length = 800 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = -3 Query: 113 NIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAY 6 ++YSFGI+LLEI+CCRK+ E KM E+++IL DWAY Sbjct: 689 DVYSFGILLLEIVCCRKNYEAKMEDEDQMILADWAY 724 >ref|XP_008380936.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Malus domestica] Length = 776 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = -3 Query: 113 NIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAY 6 ++YSFGI+LLEI+CCRK+ E KM E+++IL DWAY Sbjct: 691 DVYSFGILLLEIVCCRKNYEAKMEDEDQMILADWAY 726 >gb|KHN27126.1| G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Glycine soja] Length = 676 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/48 (52%), Positives = 38/48 (79%) Frame = -3 Query: 149 FRCNTIDPKPGLNIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAY 6 FR I K +++YSFG++LLEIICCR++++ ++G+EE+ IL DWAY Sbjct: 555 FRSAPITTK--VDVYSFGVLLLEIICCRRNVDGEVGNEEKAILTDWAY 600 >ref|XP_003555643.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1-like [Glycine max] Length = 800 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/48 (52%), Positives = 38/48 (79%) Frame = -3 Query: 149 FRCNTIDPKPGLNIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAY 6 FR I K +++YSFG++LLEIICCR++++ ++G+EE+ IL DWAY Sbjct: 679 FRSAPITTK--VDVYSFGVLLLEIICCRRNVDGEVGNEEKAILTDWAY 724 >ref|XP_010087364.1| G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Morus notabilis] gi|587838265|gb|EXB28974.1| G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Morus notabilis] Length = 681 Score = 56.2 bits (134), Expect = 8e-06 Identities = 21/37 (56%), Positives = 32/37 (86%) Frame = -3 Query: 116 LNIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAY 6 +++YSFG+VLLEI+CCRK++E+ + E ++IL DWAY Sbjct: 577 VDVYSFGVVLLEIVCCRKNVELDLEDENKIILSDWAY 613 >ref|XP_010044982.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Eucalyptus grandis] Length = 801 Score = 56.2 bits (134), Expect = 8e-06 Identities = 21/37 (56%), Positives = 32/37 (86%) Frame = -3 Query: 116 LNIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAY 6 +++YSFG++LLE ICCR+ ++++ G+EE VIL DWAY Sbjct: 691 VDVYSFGVLLLETICCRRSIDIEAGNEERVILADWAY 727 >ref|XP_012092618.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Jatropha curcas] gi|643701550|gb|KDP20397.1| hypothetical protein JCGZ_05280 [Jatropha curcas] Length = 785 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/37 (59%), Positives = 33/37 (89%) Frame = -3 Query: 116 LNIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAY 6 +++YS+G++LLEIICCRK ++++ +EEEVIL DWAY Sbjct: 677 VDVYSYGVMLLEIICCRKGLDMERENEEEVILADWAY 713 >gb|KCW87121.1| hypothetical protein EUGRSUZ_B03649 [Eucalyptus grandis] Length = 860 Score = 56.2 bits (134), Expect = 8e-06 Identities = 21/37 (56%), Positives = 32/37 (86%) Frame = -3 Query: 116 LNIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAY 6 +++YSFG++LLE ICCR+ ++++ G+EE VIL DWAY Sbjct: 750 VDVYSFGVLLLETICCRRSIDIEAGNEERVILADWAY 786 >ref|XP_004295222.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Fragaria vesca subsp. vesca] Length = 790 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/48 (52%), Positives = 37/48 (77%) Frame = -3 Query: 149 FRCNTIDPKPGLNIYSFGIVLLEIICCRKHMEVKMGHEEEVILKDWAY 6 F+ + I PK +++YSFGI+LLEIICCRK + ++ E+++IL DWAY Sbjct: 678 FKNSPITPK--VDVYSFGILLLEIICCRKKFDEEVEDEDQIILADWAY 723