BLASTX nr result
ID: Cinnamomum23_contig00046902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00046902 (421 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09807.1| hypothetical protein B456_001G168300, partial [Go... 105 6e-22 ref|NP_064095.1| orf105b gene product (mitochondrion) [Beta vulg... 93 8e-17 ref|XP_002535404.1| conserved hypothetical protein [Ricinus comm... 64 3e-08 ref|XP_002535501.1| conserved hypothetical protein [Ricinus comm... 64 3e-08 ref|YP_009049743.1| hypothetical protein (mitochondrion) [Capsic... 63 9e-08 >gb|KJB09807.1| hypothetical protein B456_001G168300, partial [Gossypium raimondii] Length = 235 Score = 105 bits (261), Expect(2) = 6e-22 Identities = 48/55 (87%), Positives = 50/55 (90%) Frame = -1 Query: 337 RFFHQSPGPCLTPCSVNRSLVDLIGPRTHESPAREE*MVPWRFMGRTFAVPLPLI 173 RFF+QSPGPCLTPCSVNRSLVDLIGPRT ESPAREE +VPWRFMGR VPLPLI Sbjct: 181 RFFYQSPGPCLTPCSVNRSLVDLIGPRTRESPAREECVVPWRFMGRALTVPLPLI 235 Score = 25.4 bits (54), Expect(2) = 6e-22 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 410 PSNQPTRGVE 381 PSNQPTRGVE Sbjct: 163 PSNQPTRGVE 172 >ref|NP_064095.1| orf105b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435118|ref|YP_004222336.1| hypothetical protein BevumaM_p102 [Beta vulgaris subsp. maritima] gi|346683210|ref|YP_004842142.1| hypothetical protein BemaM_p098 [Beta macrocarpa] gi|9087344|dbj|BAA99488.1| orf105b (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|317905672|emb|CBJ14067.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439851|emb|CBJ17557.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148061|emb|CBJ20724.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500128|emb|CBX24947.1| hypothetical protein [Beta macrocarpa] gi|384939126|emb|CBL51972.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 105 Score = 92.8 bits (229), Expect = 8e-17 Identities = 50/71 (70%), Positives = 51/71 (71%) Frame = +3 Query: 207 MKRQGTIHSSRAGLSCVRGPIRSTSDRFTEQGVKQGPGD*WKNLXXXXXXXXXXXXXXXN 386 MKRQGT+HS RAGLS VR PIRSTSDRFTEQGVKQGPG WKNL N Sbjct: 1 MKRQGTMHSPRAGLSRVRSPIRSTSDRFTEQGVKQGPGYLWKNL--------AEVSIVFN 52 Query: 387 SAGWLVGRIAF 419 SAGWLVGRIAF Sbjct: 53 SAGWLVGRIAF 63 >ref|XP_002535404.1| conserved hypothetical protein [Ricinus communis] gi|223523222|gb|EEF26978.1| conserved hypothetical protein [Ricinus communis] Length = 105 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 207 MKRQGTIHSSRAGLSCVRGPIRSTSDRFTEQGVK 308 MKRQGT+HSSRAGLS VRGPIRSTSDRFTEQGV+ Sbjct: 1 MKRQGTMHSSRAGLSRVRGPIRSTSDRFTEQGVQ 34 >ref|XP_002535501.1| conserved hypothetical protein [Ricinus communis] gi|223522871|gb|EEF26883.1| conserved hypothetical protein [Ricinus communis] Length = 88 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 207 MKRQGTIHSSRAGLSCVRGPIRSTSDRFTEQGVK 308 MKRQGT+HSSRAGLS VRGPIRSTSDRFTEQGV+ Sbjct: 1 MKRQGTMHSSRAGLSRVRGPIRSTSDRFTEQGVQ 34 >ref|YP_009049743.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751847|gb|AIG89934.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667752015|gb|AIG90101.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 106 Score = 62.8 bits (151), Expect = 9e-08 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 3/39 (7%) Frame = +2 Query: 68 IAAPLARPSRAVLACTSKQIS---LLLCRQAWASEVGLD 175 + PLARPSRAVLACTSKQIS LLLCRQAWA+EVGLD Sbjct: 68 LGPPLARPSRAVLACTSKQISSLILLLCRQAWANEVGLD 106