BLASTX nr result
ID: Cinnamomum23_contig00046815
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00046815 (265 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010277890.1| PREDICTED: putative cyclin-D6-1 [Nelumbo nuc... 63 9e-08 gb|AEV41137.1| D6-type cyclin [Populus x canadensis] 60 7e-07 gb|KHN41174.1| Putative cyclin-D6-1 [Glycine soja] 59 1e-06 ref|XP_006582337.1| PREDICTED: putative cyclin-D6-1-like isoform... 59 1e-06 ref|XP_003526300.1| PREDICTED: putative cyclin-D6-1-like isoform... 59 1e-06 ref|XP_011047492.1| PREDICTED: putative cyclin-D6-1 [Populus eup... 58 3e-06 ref|XP_010268904.1| PREDICTED: putative cyclin-D6-1 [Nelumbo nuc... 58 3e-06 gb|KHN36588.1| Putative cyclin-D6-1 [Glycine soja] 57 5e-06 ref|XP_003540333.1| PREDICTED: putative cyclin-D6-1-like [Glycin... 57 6e-06 ref|NP_001242717.1| uncharacterized protein LOC100799951 [Glycin... 57 6e-06 ref|XP_002326106.2| hypothetical protein POPTR_0019s14110g [Popu... 56 8e-06 emb|CAN88868.1| D6-type cyclin [Populus trichocarpa] 56 8e-06 >ref|XP_010277890.1| PREDICTED: putative cyclin-D6-1 [Nelumbo nucifera] Length = 319 Score = 62.8 bits (151), Expect = 9e-08 Identities = 39/72 (54%), Positives = 48/72 (66%), Gaps = 4/72 (5%) Frame = -2 Query: 255 IFDNESSSDTPVNVLDRHFLSLESEKTNSSRN----PILRPESEIKRRKLNDLCCNGSND 88 +FD SSSDTPVNVLD+++ S ESEKT SS + I E +IKRRKL+D C ND Sbjct: 253 VFDMVSSSDTPVNVLDQYYSSSESEKTGSSISIATPTIKTAERDIKRRKLSDFC----ND 308 Query: 87 TFHQLSQQMQRC 52 QLS Q+Q+C Sbjct: 309 NAFQLS-QIQQC 319 >gb|AEV41137.1| D6-type cyclin [Populus x canadensis] Length = 324 Score = 59.7 bits (143), Expect = 7e-07 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 7/58 (12%) Frame = -2 Query: 252 FDNESSSDTPVNVLDRHFLSLESEKTN-------SSRNPILRPESEIKRRKLNDLCCN 100 FD SSSDTPVNVLDRHFLS ESE TN S + PE +IKRRK++ LC N Sbjct: 251 FDMVSSSDTPVNVLDRHFLSSESENTNGTVVMISSDGSNKTWPEKDIKRRKISALCNN 308 >gb|KHN41174.1| Putative cyclin-D6-1 [Glycine soja] Length = 329 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/72 (44%), Positives = 41/72 (56%), Gaps = 4/72 (5%) Frame = -2 Query: 240 SSSDTPVNVLDRHFLSLESEKTN----SSRNPILRPESEIKRRKLNDLCCNGSNDTFHQL 73 SSSDTP+NVLD HFLS ES+KTN ++ + P ++KRRK+ C G+N T H Sbjct: 258 SSSDTPINVLDHHFLSSESQKTNGITVANTIAVSSPLRDLKRRKITGCGCGGNNPTIHNS 317 Query: 72 SQQMQRC*ERVK 37 Q E K Sbjct: 318 RIQFSHAKESEK 329 >ref|XP_006582337.1| PREDICTED: putative cyclin-D6-1-like isoform X2 [Glycine max] Length = 326 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/72 (44%), Positives = 41/72 (56%), Gaps = 4/72 (5%) Frame = -2 Query: 240 SSSDTPVNVLDRHFLSLESEKTN----SSRNPILRPESEIKRRKLNDLCCNGSNDTFHQL 73 SSSDTP+NVLD HFLS ES+KTN ++ + P ++KRRK+ C G+N T H Sbjct: 255 SSSDTPINVLDHHFLSSESQKTNGITVANTIAVSSPLRDLKRRKITGCGCGGNNPTIHNS 314 Query: 72 SQQMQRC*ERVK 37 Q E K Sbjct: 315 RIQFSHAKESEK 326 >ref|XP_003526300.1| PREDICTED: putative cyclin-D6-1-like isoform X1 [Glycine max] Length = 329 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/72 (44%), Positives = 41/72 (56%), Gaps = 4/72 (5%) Frame = -2 Query: 240 SSSDTPVNVLDRHFLSLESEKTN----SSRNPILRPESEIKRRKLNDLCCNGSNDTFHQL 73 SSSDTP+NVLD HFLS ES+KTN ++ + P ++KRRK+ C G+N T H Sbjct: 258 SSSDTPINVLDHHFLSSESQKTNGITVANTIAVSSPLRDLKRRKITGCGCGGNNPTIHNS 317 Query: 72 SQQMQRC*ERVK 37 Q E K Sbjct: 318 RIQFSHAKESEK 329 >ref|XP_011047492.1| PREDICTED: putative cyclin-D6-1 [Populus euphratica] Length = 324 Score = 57.8 bits (138), Expect = 3e-06 Identities = 33/58 (56%), Positives = 38/58 (65%), Gaps = 7/58 (12%) Frame = -2 Query: 252 FDNESSSDTPVNVLDRHFLSLESEKTN-------SSRNPILRPESEIKRRKLNDLCCN 100 FD SSSDTPVNVLDRHF S ESE TN S+ + PE +IKRRK++ LC N Sbjct: 251 FDMVSSSDTPVNVLDRHFSSSESENTNGTVVMISSNGSNKTWPEKDIKRRKISALCNN 308 >ref|XP_010268904.1| PREDICTED: putative cyclin-D6-1 [Nelumbo nucifera] Length = 321 Score = 57.8 bits (138), Expect = 3e-06 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 2/69 (2%) Frame = -2 Query: 252 FDNESSSDTPVNVLDRHFLSLESEKTNS--SRNPILRPESEIKRRKLNDLCCNGSNDTFH 79 FD SSSDTP NVLD+ + S ESEKT S + I E +IKRRK+ND C S++TF Sbjct: 254 FDIVSSSDTPDNVLDQQYSSTESEKTGSTIATTVIRAAERDIKRRKINDFC---SDNTF- 309 Query: 78 QLSQQMQRC 52 QLS Q+Q+C Sbjct: 310 QLS-QIQQC 317 >gb|KHN36588.1| Putative cyclin-D6-1 [Glycine soja] Length = 316 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = -2 Query: 264 ESIIFDNESSSDTPVNVLDRHFLSLESEKTNSSRNPILRPESEIKRRKLND 112 ES++ N S+SDTPVNVLD HFLSLESEKTN + N ++ E + KRRK D Sbjct: 253 ESVLNIN-STSDTPVNVLDEHFLSLESEKTNGT-NVVVTQEQDFKRRKTTD 301 >ref|XP_003540333.1| PREDICTED: putative cyclin-D6-1-like [Glycine max] gi|734321875|gb|KHN04300.1| Putative cyclin-D6-1 [Glycine soja] Length = 315 Score = 56.6 bits (135), Expect = 6e-06 Identities = 36/68 (52%), Positives = 44/68 (64%), Gaps = 5/68 (7%) Frame = -2 Query: 264 ESIIFDNESSSDTPVNVLDRHFLSLESEKTNSSRNPILRPESEIKRRKLNDLCCNGSNDT 85 ES++ N S+SDTPVNVLD HFLSLESEKTN + ++ E + KRRK D G+N T Sbjct: 253 ESVLNIN-STSDTPVNVLDEHFLSLESEKTNGTN--VVTQEQDFKRRKTTDY---GNNRT 306 Query: 84 -----FHQ 76 FHQ Sbjct: 307 VPFSHFHQ 314 >ref|NP_001242717.1| uncharacterized protein LOC100799951 [Glycine max] gi|255634925|gb|ACU17821.1| unknown [Glycine max] Length = 316 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = -2 Query: 255 IFDNESSSDTPVNVLDRHFLSLESEKTNSSRNPILRPESEIKRRKLND 112 + + S+SDTPVNVLD HFLSLESEKTN + N ++ E + KRRK D Sbjct: 255 VLNINSTSDTPVNVLDEHFLSLESEKTNGT-NVVVTQEQDFKRRKTTD 301 >ref|XP_002326106.2| hypothetical protein POPTR_0019s14110g [Populus trichocarpa] gi|550317529|gb|EEF00488.2| hypothetical protein POPTR_0019s14110g [Populus trichocarpa] Length = 324 Score = 56.2 bits (134), Expect = 8e-06 Identities = 33/58 (56%), Positives = 37/58 (63%), Gaps = 7/58 (12%) Frame = -2 Query: 252 FDNESSSDTPVNVLDRHFLSLESEKTN-------SSRNPILRPESEIKRRKLNDLCCN 100 FD SSSDTPVNVLDRHF S ESE TN S+ + PE IKRRK++ LC N Sbjct: 251 FDMVSSSDTPVNVLDRHFSSSESENTNGTVVMISSNGSNKTWPEKGIKRRKISALCNN 308 >emb|CAN88868.1| D6-type cyclin [Populus trichocarpa] Length = 324 Score = 56.2 bits (134), Expect = 8e-06 Identities = 33/58 (56%), Positives = 37/58 (63%), Gaps = 7/58 (12%) Frame = -2 Query: 252 FDNESSSDTPVNVLDRHFLSLESEKTN-------SSRNPILRPESEIKRRKLNDLCCN 100 FD SSSDTPVNVLDRHF S ESE TN S+ + PE IKRRK++ LC N Sbjct: 251 FDMVSSSDTPVNVLDRHFSSSESENTNGTVVMISSNGSNKTWPEKGIKRRKISALCNN 308