BLASTX nr result
ID: Cinnamomum23_contig00046513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00046513 (210 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIX93772.1| hypothetical protein Z520_10396 [Fonsecaea multim... 58 3e-06 gb|KIW80415.1| hypothetical protein Z517_07030 [Fonsecaea pedros... 57 6e-06 gb|KIW68752.1| hypothetical protein PV04_04676 [Capronia semiimm... 57 6e-06 ref|XP_007756789.1| aquaglyceroporin like protein, other eukaryo... 57 6e-06 ref|XP_008726666.1| hypothetical protein G647_04100 [Cladophialo... 57 6e-06 gb|KIV93113.1| hypothetical protein PV10_04353 [Exophiala mesoph... 56 8e-06 >gb|KIX93772.1| hypothetical protein Z520_10396 [Fonsecaea multimorphosa CBS 102226] Length = 353 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 210 FMFTGETPIDTPAIGLTRLIKPNRETWSNTY 118 F+FTGE+PI+TP +GL R +KPNRETWSNTY Sbjct: 315 FLFTGESPINTPFLGLARFLKPNRETWSNTY 345 >gb|KIW80415.1| hypothetical protein Z517_07030 [Fonsecaea pedrosoi CBS 271.37] Length = 353 Score = 56.6 bits (135), Expect = 6e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 210 FMFTGETPIDTPAIGLTRLIKPNRETWSNTY 118 F+FTGE+PI+TP +GL R +KPNR TWSNTY Sbjct: 315 FLFTGESPINTPVVGLARFLKPNRATWSNTY 345 >gb|KIW68752.1| hypothetical protein PV04_04676 [Capronia semiimmersa] gi|759292337|gb|KIW68753.1| hypothetical protein, variant 1 [Capronia semiimmersa] Length = 378 Score = 56.6 bits (135), Expect = 6e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 210 FMFTGETPIDTPAIGLTRLIKPNRETWSNTY 118 F+FTGE+PI+TP +GL R +KPNR TWSNTY Sbjct: 340 FLFTGESPINTPVVGLMRFLKPNRSTWSNTY 370 >ref|XP_007756789.1| aquaglyceroporin like protein, other eukaryote [Cladophialophora yegresii CBS 114405] gi|589977152|gb|EXJ60436.1| aquaglyceroporin like protein, other eukaryote [Cladophialophora yegresii CBS 114405] Length = 353 Score = 56.6 bits (135), Expect = 6e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 210 FMFTGETPIDTPAIGLTRLIKPNRETWSNTY 118 F+FTGE+PI+TP +GL R +KPNR TWSNTY Sbjct: 315 FLFTGESPINTPVVGLMRFLKPNRSTWSNTY 345 >ref|XP_008726666.1| hypothetical protein G647_04100 [Cladophialophora carrionii CBS 160.54] gi|565935501|gb|ETI24730.1| hypothetical protein G647_04100 [Cladophialophora carrionii CBS 160.54] Length = 353 Score = 56.6 bits (135), Expect = 6e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 210 FMFTGETPIDTPAIGLTRLIKPNRETWSNTY 118 F+FTGE+PI+TP +GL R +KPNR TWSNTY Sbjct: 315 FLFTGESPINTPVVGLMRFLKPNRSTWSNTY 345 >gb|KIV93113.1| hypothetical protein PV10_04353 [Exophiala mesophila] Length = 360 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = -1 Query: 210 FMFTGETPIDTPAIGLTRLIKPNRETWSNTY 118 F+FTGE+PI+TPA+GL R ++PNR+TWSNTY Sbjct: 326 FLFTGESPINTPAMGLKRFLQPNRKTWSNTY 356