BLASTX nr result
ID: Cinnamomum23_contig00046502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00046502 (307 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011020843.1| PREDICTED: uncharacterized protein LOC105123... 57 6e-06 ref|XP_002512643.1| conserved hypothetical protein [Ricinus comm... 56 8e-06 >ref|XP_011020843.1| PREDICTED: uncharacterized protein LOC105123074 [Populus euphratica] Length = 652 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -2 Query: 156 AKKERLKPELARRVVERYESDSNYRFLYDRISDFFAASLKTDIGYLYSCELR 1 A+KER + +A++V+ERY D +YRFLY+ +SDFFA LKTD+ +L S R Sbjct: 239 ARKER-RAAMAKKVIERYSHDPDYRFLYEGVSDFFAGCLKTDMQHLNSSNTR 289 >ref|XP_002512643.1| conserved hypothetical protein [Ricinus communis] gi|223548604|gb|EEF50095.1| conserved hypothetical protein [Ricinus communis] Length = 657 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/60 (46%), Positives = 39/60 (65%) Frame = -2 Query: 180 RRGLERIWAKKERLKPELARRVVERYESDSNYRFLYDRISDFFAASLKTDIGYLYSCELR 1 + L R W K +A++V +RY D ++RFLYDR+SDFFA LK+DI YL S ++R Sbjct: 240 KASLSRKWKKVA-----MAKKVFDRYSRDPDFRFLYDRVSDFFANCLKSDIEYLKSGQIR 294