BLASTX nr result
ID: Cinnamomum23_contig00045904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00045904 (274 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010260710.1| PREDICTED: anthocyanidin 3-O-glucosyltransfe... 57 5e-06 ref|XP_008789832.1| PREDICTED: anthocyanidin 3-O-glucosyltransfe... 57 6e-06 >ref|XP_010260710.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Nelumbo nucifera] gi|720015067|ref|XP_010260711.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Nelumbo nucifera] Length = 478 Score = 57.0 bits (136), Expect = 5e-06 Identities = 34/79 (43%), Positives = 45/79 (56%), Gaps = 1/79 (1%) Frame = +3 Query: 12 HGKQQFSITILLIYLKRPTLQSKTTTYIQSIAA*RPGIRFVNLPFVDLPSNEDQN-PITF 188 H + SIT+L + RP Y++S+AA P IRF+ LP VD PS E N P F Sbjct: 29 HRDDRLSITVLCM---RPPSFYGVDPYVESLAASNPSIRFIGLPQVDPPSPEVYNGPEGF 85 Query: 189 VSLIMEKQKPHVKEAIKTL 245 +SL +E KPHV+ A+ L Sbjct: 86 ISLFVESYKPHVRHALTQL 104 >ref|XP_008789832.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like, partial [Phoenix dactylifera] Length = 424 Score = 56.6 bits (135), Expect = 6e-06 Identities = 30/73 (41%), Positives = 45/73 (61%) Frame = +3 Query: 18 KQQFSITILLIYLKRPTLQSKTTTYIQSIAA*RPGIRFVNLPFVDLPSNEDQNPITFVSL 197 + FS+T+LLI P S + Y+QS+A+ IRF +LP VD P++ D + F+SL Sbjct: 34 ENHFSVTVLLIQSPNPASASTFSPYVQSVASSGLDIRFQDLPPVDPPTDTD-GALDFISL 92 Query: 198 IMEKQKPHVKEAI 236 ++ KPHVK A+ Sbjct: 93 YIQSHKPHVKAAL 105