BLASTX nr result
ID: Cinnamomum23_contig00045587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00045587 (662 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA37676.1| TPA: hypothetical protein ZEAMMB73_822305 [Zea m... 60 8e-07 >tpg|DAA37676.1| TPA: hypothetical protein ZEAMMB73_822305 [Zea mays] Length = 285 Score = 60.5 bits (145), Expect = 8e-07 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = -3 Query: 660 MHLGVLATASHALSTGTLFSVFYKPRFDCSSQLYHFYYIYITL 532 MHLGVLATASHA+STGTLFSVFYKPRFD Y+YI L Sbjct: 243 MHLGVLATASHAISTGTLFSVFYKPRFDVV-----LLYLYICL 280