BLASTX nr result
ID: Cinnamomum23_contig00045558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00045558 (261 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78792.1| hypothetical protein VITISV_007508 [Vitis vinifera] 63 9e-08 >emb|CAN78792.1| hypothetical protein VITISV_007508 [Vitis vinifera] Length = 285 Score = 62.8 bits (151), Expect = 9e-08 Identities = 27/54 (50%), Positives = 39/54 (72%) Frame = +1 Query: 100 YLDVGVIRMQDASSFDLLAWWKQQESVHPVLAATTRDLLTISMSSVASELAFSA 261 YL++ +I +D FD+L WWK Q+ +PVL+ RD+LT+ +S+VASE AFSA Sbjct: 162 YLNIDLISFEDDEDFDILIWWKSQQHKYPVLSIIARDVLTVPVSTVASEAAFSA 215