BLASTX nr result
ID: Cinnamomum23_contig00045320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00045320 (348 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010259497.1| PREDICTED: U-box domain-containing protein 1... 62 1e-07 ref|XP_010274639.1| PREDICTED: U-box domain-containing protein 1... 57 4e-06 ref|XP_012846142.1| PREDICTED: U-box domain-containing protein 1... 56 8e-06 ref|XP_012846140.1| PREDICTED: U-box domain-containing protein 1... 56 8e-06 >ref|XP_010259497.1| PREDICTED: U-box domain-containing protein 11-like [Nelumbo nucifera] Length = 639 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/43 (67%), Positives = 37/43 (86%) Frame = +2 Query: 185 LLDLVREIGRIGDFAADFKRDCADLARRISLLSHLLEEIRDFK 313 LLDLV++IGRIG F +K++C+DL RRI+LLS+L EEIRDFK Sbjct: 13 LLDLVQDIGRIGAFGDVYKKECSDLCRRIALLSYLFEEIRDFK 55 >ref|XP_010274639.1| PREDICTED: U-box domain-containing protein 11-like [Nelumbo nucifera] Length = 644 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = +2 Query: 173 MDLPLLDLVREIGRIGDFAADFKRDCADLARRISLLSHLLEEIRDFK 313 M LLDLV ++GRI F F+R+C+ L+RRISLLS L EEIRDF+ Sbjct: 9 MGQALLDLVHDVGRINGFGDTFRRECSYLSRRISLLSFLFEEIRDFQ 55 >ref|XP_012846142.1| PREDICTED: U-box domain-containing protein 11 isoform X2 [Erythranthe guttatus] Length = 646 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/44 (63%), Positives = 35/44 (79%), Gaps = 2/44 (4%) Frame = +2 Query: 188 LDLVREIGRIGD--FAADFKRDCADLARRISLLSHLLEEIRDFK 313 L L+R++ RI F+ FK+DCADLARR+SLL+HLLEEIRD K Sbjct: 18 LRLIRDVARISTAGFSGVFKKDCADLARRVSLLAHLLEEIRDSK 61 >ref|XP_012846140.1| PREDICTED: U-box domain-containing protein 11 isoform X1 [Erythranthe guttatus] gi|604318558|gb|EYU30050.1| hypothetical protein MIMGU_mgv1a002663mg [Erythranthe guttata] Length = 649 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/44 (63%), Positives = 35/44 (79%), Gaps = 2/44 (4%) Frame = +2 Query: 188 LDLVREIGRIGD--FAADFKRDCADLARRISLLSHLLEEIRDFK 313 L L+R++ RI F+ FK+DCADLARR+SLL+HLLEEIRD K Sbjct: 18 LRLIRDVARISTAGFSGVFKKDCADLARRVSLLAHLLEEIRDSK 61