BLASTX nr result
ID: Cinnamomum23_contig00045307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00045307 (497 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78850.1| hypothetical protein (mitochondrion) [Vicia faba] 96 1e-17 ref|XP_003588304.1| hypothetical protein MTR_1g005660 [Medicago ... 94 3e-17 ref|XP_002535496.1| conserved hypothetical protein [Ricinus comm... 79 2e-12 >gb|AGC78850.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 91 Score = 95.5 bits (236), Expect = 1e-17 Identities = 45/47 (95%), Positives = 45/47 (95%) Frame = -2 Query: 496 KRTTSILGAEVYEEWLFGPFRPVVRTSSFHVEDTGSIPVRDRYSFPA 356 KRTT ILGAEVYEEWLFGPFRPVVRTSSFHVEDTGSIPVRD YSFPA Sbjct: 42 KRTTYILGAEVYEEWLFGPFRPVVRTSSFHVEDTGSIPVRDGYSFPA 88 >ref|XP_003588304.1| hypothetical protein MTR_1g005660 [Medicago truncatula] Length = 129 Score = 94.4 bits (233), Expect = 3e-17 Identities = 45/47 (95%), Positives = 45/47 (95%) Frame = -2 Query: 496 KRTTSILGAEVYEEWLFGPFRPVVRTSSFHVEDTGSIPVRDRYSFPA 356 KRTTSILGAEVYEEWLFG FRPVVRTSSFHVEDTGSIPVRD YSFPA Sbjct: 42 KRTTSILGAEVYEEWLFGRFRPVVRTSSFHVEDTGSIPVRDGYSFPA 88 >ref|XP_002535496.1| conserved hypothetical protein [Ricinus communis] gi|255596832|ref|XP_002536626.1| conserved hypothetical protein [Ricinus communis] gi|223519048|gb|EEF25756.1| conserved hypothetical protein [Ricinus communis] gi|223522900|gb|EEF26887.1| conserved hypothetical protein [Ricinus communis] Length = 59 Score = 78.6 bits (192), Expect = 2e-12 Identities = 44/62 (70%), Positives = 50/62 (80%) Frame = +1 Query: 139 VAEGRRERTHAWRFFLSEVRESMKGHLRLRKNSRKSITEKW*SHLVLLAGREEAPGQPFP 318 +AE RR+RTHAW LSE+++SMK HLRLRKNSRKSITE+ LVLLAGREEA G PF Sbjct: 1 MAERRRKRTHAWS--LSEMKKSMKRHLRLRKNSRKSITERS-GDLVLLAGREEASGPPFS 57 Query: 319 AR 324 AR Sbjct: 58 AR 59