BLASTX nr result
ID: Cinnamomum23_contig00045301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00045301 (504 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73395.1| hypothetical protein VITISV_003815 [Vitis vinifera] 42 2e-06 >emb|CAN73395.1| hypothetical protein VITISV_003815 [Vitis vinifera] Length = 1036 Score = 41.6 bits (96), Expect(2) = 2e-06 Identities = 19/35 (54%), Positives = 24/35 (68%) Frame = -3 Query: 502 DDEEGIQSLNTFCSSQFDMKDLSCL*YVLGIEVVY 398 DD GIQ L F S QF+MKDL L Y+LG+E+ + Sbjct: 728 DDLSGIQELKDFLSQQFEMKDLGHLNYLLGLEITH 762 Score = 36.6 bits (83), Expect(2) = 2e-06 Identities = 20/42 (47%), Positives = 28/42 (66%) Frame = -1 Query: 402 STLQSYLLSQMNYLGDLLQRAGLSNSKTICTPLETN*KLSIS 277 ST Y+ +Q Y DLL +AGL++SKT+ TP+E N L+ S Sbjct: 763 STYDLYI-TQAKYASDLLSQAGLTDSKTVDTPVELNVHLTPS 803