BLASTX nr result
ID: Cinnamomum23_contig00045292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00045292 (366 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011623588.1| PREDICTED: pentatricopeptide repeat-containi... 122 9e-26 gb|ERN06533.1| hypothetical protein AMTR_s00058p00105900 [Ambore... 122 9e-26 ref|XP_006844721.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 ref|XP_010090943.1| hypothetical protein L484_007578 [Morus nota... 81 3e-13 ref|XP_010680017.1| PREDICTED: pentatricopeptide repeat-containi... 78 2e-12 ref|XP_011625118.1| PREDICTED: putative pentatricopeptide repeat... 77 4e-12 gb|ERN10517.1| hypothetical protein AMTR_s00166p00033330 [Ambore... 77 4e-12 ref|XP_012071535.1| PREDICTED: pentatricopeptide repeat-containi... 77 6e-12 ref|XP_010062241.1| PREDICTED: pentatricopeptide repeat-containi... 76 8e-12 ref|XP_009616391.1| PREDICTED: pentatricopeptide repeat-containi... 76 8e-12 ref|XP_008465705.1| PREDICTED: pentatricopeptide repeat-containi... 76 8e-12 gb|KCW69344.1| hypothetical protein EUGRSUZ_F02828 [Eucalyptus g... 76 8e-12 ref|XP_011463034.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_011091407.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 ref|XP_011003604.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 ref|XP_002301563.2| hypothetical protein POPTR_0002s22630g, part... 75 2e-11 ref|XP_010937211.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_008231210.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_010246108.1| PREDICTED: pentatricopeptide repeat-containi... 74 4e-11 ref|XP_008785897.1| PREDICTED: pentatricopeptide repeat-containi... 74 5e-11 >ref|XP_011623588.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Amborella trichopoda] Length = 623 Score = 122 bits (306), Expect = 9e-26 Identities = 56/119 (47%), Positives = 80/119 (67%) Frame = -3 Query: 358 MPPLLHFPITKTNYKSIVEEIFSFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLC 179 M P LH P + K I E +FS L +T +H+ + A++F GLHQNNF+A K+L C Sbjct: 1 MRPPLHSPFALSPNKLIEEALFSLLDHCSTHNHIREAHARIFVLGLHQNNFLAAKILGAC 60 Query: 178 SSTSSISHALLIFHHIKNPSISLFNSLIRALSQHNHPLQALHSYSLMKHAQIPPDNFTF 2 SS S+I+HA+L F H NP+I L+N+LIRAL+Q+N P + + Y+ M+ +PPDNFT+ Sbjct: 61 SSVSAINHAILAFKHASNPTICLYNTLIRALAQNNLPFETIDLYTAMRRNSLPPDNFTY 119 >gb|ERN06533.1| hypothetical protein AMTR_s00058p00105900 [Amborella trichopoda] Length = 192 Score = 122 bits (306), Expect = 9e-26 Identities = 56/119 (47%), Positives = 80/119 (67%) Frame = -3 Query: 358 MPPLLHFPITKTNYKSIVEEIFSFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLC 179 M P LH P + K I E +FS L +T +H+ + A++F GLHQNNF+A K+L C Sbjct: 1 MRPPLHSPFALSPNKLIEEALFSLLDHCSTHNHIREAHARIFVLGLHQNNFLAAKILGAC 60 Query: 178 SSTSSISHALLIFHHIKNPSISLFNSLIRALSQHNHPLQALHSYSLMKHAQIPPDNFTF 2 SS S+I+HA+L F H NP+I L+N+LIRAL+Q+N P + + Y+ M+ +PPDNFT+ Sbjct: 61 SSVSAINHAILAFKHASNPTICLYNTLIRALAQNNLPFETIDLYTAMRRNSLPPDNFTY 119 >ref|XP_006844721.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26630, chloroplastic [Amborella trichopoda] gi|548847192|gb|ERN06396.1| hypothetical protein AMTR_s00016p00252780 [Amborella trichopoda] Length = 428 Score = 82.0 bits (201), Expect = 1e-13 Identities = 40/100 (40%), Positives = 62/100 (62%) Frame = -3 Query: 301 EIFSFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLCSSTSSISHALLIFHHIKNP 122 + S L +T +HL Q+ A +F +GLH++ + TKL+NLCS I HA L+F+ I+NP Sbjct: 33 QALSLLQKCSTSNHLLQIHAHLFRTGLHRDYILITKLINLCSIHQKIDHATLVFNQIENP 92 Query: 121 SISLFNSLIRALSQHNHPLQALHSYSLMKHAQIPPDNFTF 2 +N++IRA + N+P +A+ Y+LM PD FT+ Sbjct: 93 LTFTWNTMIRAYFKSNYPEEAILMYNLMVIHGFLPDKFTY 132 >ref|XP_010090943.1| hypothetical protein L484_007578 [Morus notabilis] gi|587851274|gb|EXB41428.1| hypothetical protein L484_007578 [Morus notabilis] Length = 428 Score = 80.9 bits (198), Expect = 3e-13 Identities = 45/118 (38%), Positives = 66/118 (55%), Gaps = 1/118 (0%) Frame = -3 Query: 352 PLLHFPITKTNYKSIVEEIFSFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLCSS 173 P P +KT + S EE F+FL T+F L Q+ AK+ SGL + + K+L CS+ Sbjct: 9 PFSSTPTSKTKFGS--EEAFTFLQNCTSFRQLKQIHAKIIRSGLSHDQLLLRKMLQFCST 66 Query: 172 TSSISHALLIF-HHIKNPSISLFNSLIRALSQHNHPLQALHSYSLMKHAQIPPDNFTF 2 + ++ +A L+F H I P +N +IRA + + P QAL ++LM PPD FTF Sbjct: 67 SGNMDYAALVFRHQIPYPLTFTWNLMIRAYTLNASPRQALLLFTLMTSRGFPPDKFTF 124 >ref|XP_010680017.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26630, chloroplastic [Beta vulgaris subsp. vulgaris] gi|870858163|gb|KMT09689.1| hypothetical protein BVRB_6g131390 [Beta vulgaris subsp. vulgaris] Length = 417 Score = 78.2 bits (191), Expect = 2e-12 Identities = 42/98 (42%), Positives = 60/98 (61%) Frame = -3 Query: 295 FSFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLCSSTSSISHALLIFHHIKNPSI 116 FS L T+ HLTQ+ AK+ S L N+ +AT+LL L SS ++++A IFHHI +PS Sbjct: 21 FSLLQNCTSPQHLTQIHAKIIRSNLTSNHLVATQLLRLYSSYGNLNYATSIFHHIPSPST 80 Query: 115 SLFNSLIRALSQHNHPLQALHSYSLMKHAQIPPDNFTF 2 +N +IRA + + Q+L Y+LM + PD FTF Sbjct: 81 FTWNLIIRAHTINGSSSQSLILYNLMICTGVAPDKFTF 118 >ref|XP_011625118.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g37570 [Amborella trichopoda] Length = 567 Score = 77.0 bits (188), Expect = 4e-12 Identities = 41/98 (41%), Positives = 62/98 (63%), Gaps = 1/98 (1%) Frame = -3 Query: 292 SFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLCSSTSSISHALLIFHHIKNPSIS 113 S L T+ HL Q+ A +F + LH NN +A KLL+L SS S+I +A L+FH + +P++S Sbjct: 12 SLLKRCTSLSHLNQIHAAIFRTQLHSNNSLAAKLLSLSSSLSTIQYAHLVFHCVPHPNLS 71 Query: 112 LFNSLIRALSQHNHPLQALHSYSLM-KHAQIPPDNFTF 2 L+N LI+ +++ QAL Y+ M + P+NFTF Sbjct: 72 LWNELIKTHVKNSLHTQALSFYAAMTATTPLKPNNFTF 109 >gb|ERN10517.1| hypothetical protein AMTR_s00166p00033330 [Amborella trichopoda] Length = 240 Score = 77.0 bits (188), Expect = 4e-12 Identities = 41/98 (41%), Positives = 62/98 (63%), Gaps = 1/98 (1%) Frame = -3 Query: 292 SFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLCSSTSSISHALLIFHHIKNPSIS 113 S L T+ HL Q+ A +F + LH NN +A KLL+L SS S+I +A L+FH + +P++S Sbjct: 12 SLLKRCTSLSHLNQIHAAIFRTQLHSNNSLAAKLLSLSSSLSTIQYAHLVFHCVPHPNLS 71 Query: 112 LFNSLIRALSQHNHPLQALHSYSLM-KHAQIPPDNFTF 2 L+N LI+ +++ QAL Y+ M + P+NFTF Sbjct: 72 LWNELIKTHVKNSLHTQALSFYAAMTATTPLKPNNFTF 109 >ref|XP_012071535.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Jatropha curcas] gi|802592351|ref|XP_012071536.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Jatropha curcas] gi|643731417|gb|KDP38705.1| hypothetical protein JCGZ_04058 [Jatropha curcas] Length = 791 Score = 76.6 bits (187), Expect = 6e-12 Identities = 42/98 (42%), Positives = 59/98 (60%), Gaps = 1/98 (1%) Frame = -3 Query: 292 SFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLCSSTSSISHALLIFHHIKNPSIS 113 +FL+ STT HLTQL A++ SGL + +ATKL + SS HA +F + P + Sbjct: 21 NFLNKSTTLSHLTQLHAQLLLSGLQDDLAVATKLTHKLFDFSSTHHARALFFTVPKPDLF 80 Query: 112 LFNSLIRALSQHNHPLQALHSYS-LMKHAQIPPDNFTF 2 LFN LI+ LS +N PL A+ ++ L K + PDNFT+ Sbjct: 81 LFNVLIKGLSVNNSPLSAISIFTHLRKSTDLYPDNFTY 118 >ref|XP_010062241.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770 [Eucalyptus grandis] Length = 744 Score = 76.3 bits (186), Expect = 8e-12 Identities = 38/103 (36%), Positives = 61/103 (59%), Gaps = 1/103 (0%) Frame = -3 Query: 307 VEEIF-SFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLCSSTSSISHALLIFHHI 131 ++E F S + ST+ HL Q+ AK+ GLH+++F+ TKL+N S+ I ++ +F Sbjct: 72 LDEFFASLIENSTSLRHLNQIHAKLLVLGLHKDSFLITKLVNWSSNLGEIRYSRKVFDEF 131 Query: 130 KNPSISLFNSLIRALSQHNHPLQALHSYSLMKHAQIPPDNFTF 2 +P + L+N++IR S+HN A+ YS M + PD FTF Sbjct: 132 SDPDVFLWNAIIRGYSRHNMFSDAVELYSEMLGTGVSPDGFTF 174 >ref|XP_009616391.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nicotiana tomentosiformis] gi|697124769|ref|XP_009616392.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nicotiana tomentosiformis] gi|697124771|ref|XP_009616393.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nicotiana tomentosiformis] gi|697124773|ref|XP_009616394.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nicotiana tomentosiformis] Length = 552 Score = 76.3 bits (186), Expect = 8e-12 Identities = 33/112 (29%), Positives = 68/112 (60%) Frame = -3 Query: 337 PITKTNYKSIVEEIFSFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLCSSTSSIS 158 P K +++ + +FS L + LTQ+ A + T+G Q NFI +LL+ ++ ++ Sbjct: 8 PAKKRGSRALQQRLFSLLQNCKSIKQLTQIHAPIITNGFTQKNFILVRLLSPFLTSYNLK 67 Query: 157 HALLIFHHIKNPSISLFNSLIRALSQHNHPLQALHSYSLMKHAQIPPDNFTF 2 +A +F+H++NPS +L+N +IR ++ +P +++ ++LM+ + PD +T+ Sbjct: 68 YADQVFYHVQNPSTTLWNQIIRGYARSENPQKSVELFNLMEKSTATPDGYTY 119 >ref|XP_008465705.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like isoform X1 [Cucumis melo] gi|659131477|ref|XP_008465706.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like isoform X1 [Cucumis melo] Length = 532 Score = 76.3 bits (186), Expect = 8e-12 Identities = 39/89 (43%), Positives = 56/89 (62%), Gaps = 2/89 (2%) Frame = -3 Query: 265 HHLTQLQAKVFTSGLHQNNFIATKLLNLC--SSTSSISHALLIFHHIKNPSISLFNSLIR 92 +HL Q A+V TSGLH +NF+ +KLLN C S S+SHA +F HI++P+I + N++I+ Sbjct: 19 NHLKQAHAQVLTSGLHNSNFVLSKLLNFCAESRNGSLSHAFKLFQHIQHPTICICNTMIK 78 Query: 91 ALSQHNHPLQALHSYSLMKHAQIPPDNFT 5 AL L A+ +S M I PD +T Sbjct: 79 ALLLRGEFLNAIVVFSAMFRNGIHPDTYT 107 >gb|KCW69344.1| hypothetical protein EUGRSUZ_F02828 [Eucalyptus grandis] Length = 734 Score = 76.3 bits (186), Expect = 8e-12 Identities = 38/103 (36%), Positives = 61/103 (59%), Gaps = 1/103 (0%) Frame = -3 Query: 307 VEEIF-SFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLCSSTSSISHALLIFHHI 131 ++E F S + ST+ HL Q+ AK+ GLH+++F+ TKL+N S+ I ++ +F Sbjct: 72 LDEFFASLIENSTSLRHLNQIHAKLLVLGLHKDSFLITKLVNWSSNLGEIRYSRKVFDEF 131 Query: 130 KNPSISLFNSLIRALSQHNHPLQALHSYSLMKHAQIPPDNFTF 2 +P + L+N++IR S+HN A+ YS M + PD FTF Sbjct: 132 SDPDVFLWNAIIRGYSRHNMFSDAVELYSEMLGTGVSPDGFTF 174 >ref|XP_011463034.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790-like [Fragaria vesca subsp. vesca] Length = 534 Score = 75.5 bits (184), Expect = 1e-11 Identities = 41/108 (37%), Positives = 58/108 (53%), Gaps = 2/108 (1%) Frame = -3 Query: 322 NYKSIVEEIFSFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLCSST--SSISHAL 149 +Y S L HL Q A+VFTSGL N F ++LL LCS S+S+AL Sbjct: 2 SYSSSSTRCLQLLEKCRNLKHLHQAHAQVFTSGLAHNTFALSRLLALCSHPHHGSLSYAL 61 Query: 148 LIFHHIKNPSISLFNSLIRALSQHNHPLQALHSYSLMKHAQIPPDNFT 5 +FHHI P++ ++N+L++ L N Q L+ Y+ M PDN+T Sbjct: 62 KLFHHIPQPTLCIYNTLLKTLLLRNELTQTLNVYTHMLQTGTYPDNYT 109 >ref|XP_011091407.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26630, chloroplastic [Sesamum indicum] Length = 422 Score = 75.1 bits (183), Expect = 2e-11 Identities = 38/101 (37%), Positives = 60/101 (59%) Frame = -3 Query: 304 EEIFSFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLCSSTSSISHALLIFHHIKN 125 E+ FL T+F + Q+ A++ S LH++ I T+L+ LCSS + +A L+F I+N Sbjct: 29 EDALVFLERCTSFKQMKQIHARIIRSSLHRHQVIVTRLIRLCSSYGKLDYATLVFEQIEN 88 Query: 124 PSISLFNSLIRALSQHNHPLQALHSYSLMKHAQIPPDNFTF 2 PS +N LIRA + ++ L+A+ Y+LM + D FTF Sbjct: 89 PSTFAWNLLIRAYTVNDCSLRAIIFYNLMICRGVDVDKFTF 129 >ref|XP_011003604.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26630, chloroplastic [Populus euphratica] gi|743919173|ref|XP_011003605.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26630, chloroplastic [Populus euphratica] Length = 491 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/100 (36%), Positives = 55/100 (55%) Frame = -3 Query: 301 EIFSFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLCSSTSSISHALLIFHHIKNP 122 E L T+F+HL + K+ + L N + KL++LCSS + +A L+FH ++ P Sbjct: 42 EALLLLQNCTSFNHLKLVHGKIIRNALSANQLLVRKLIHLCSSYGRLDYAALLFHQVQEP 101 Query: 121 SISLFNSLIRALSQHNHPLQALHSYSLMKHAQIPPDNFTF 2 +N LIR + H + ++AL Y+LM PPD FTF Sbjct: 102 HTFTWNFLIRTYTIHGYSMKALLLYNLMIRRGFPPDKFTF 141 >ref|XP_002301563.2| hypothetical protein POPTR_0002s22630g, partial [Populus trichocarpa] gi|550345613|gb|EEE80836.2| hypothetical protein POPTR_0002s22630g, partial [Populus trichocarpa] Length = 245 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/100 (36%), Positives = 55/100 (55%) Frame = -3 Query: 301 EIFSFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLCSSTSSISHALLIFHHIKNP 122 E L T+F+HL + K+ + L N + KL++LCSS + +A L+FH ++ P Sbjct: 42 EALLLLQNCTSFNHLKLVHGKIIRNALSANQLLVRKLIHLCSSYGRLDYAALLFHQVQEP 101 Query: 121 SISLFNSLIRALSQHNHPLQALHSYSLMKHAQIPPDNFTF 2 +N LIR + H + ++AL Y+LM PPD FTF Sbjct: 102 HTFTWNFLIRTYTIHGYSMKALLLYNLMIRRGFPPDKFTF 141 >ref|XP_010937211.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Elaeis guineensis] Length = 652 Score = 74.3 bits (181), Expect = 3e-11 Identities = 38/114 (33%), Positives = 66/114 (57%), Gaps = 1/114 (0%) Frame = -3 Query: 340 FPITKTNYKSIVEEIFSFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLCSSTSSI 161 F + ++ + + + +FS L + L Q+ A++ +G Q NF+ TKLL+ C S++++ Sbjct: 22 FLLPPSSSRDLQQRLFSILQGCKSTRELAQMHAQLLVNGFSQKNFLITKLLSFCVSSNNL 81 Query: 160 SHALLIFHHIKNPSISLFNSLIRALSQHNHPLQALHSYSLMK-HAQIPPDNFTF 2 HA F +K PS +L+N +IRA S+ P +L Y+ M+ A P++FTF Sbjct: 82 YHATQAFDMVKEPSTTLYNQMIRAFSRSAMPETSLKFYNRMRASAMAQPNSFTF 135 >ref|XP_008231210.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26630, chloroplastic [Prunus mume] gi|645250432|ref|XP_008231211.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26630, chloroplastic [Prunus mume] Length = 439 Score = 74.3 bits (181), Expect = 3e-11 Identities = 38/101 (37%), Positives = 56/101 (55%) Frame = -3 Query: 304 EEIFSFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLCSSTSSISHALLIFHHIKN 125 +E + L TF HL Q+ AK+ +GL + + KL++LCSS + +A LIFH I+ Sbjct: 30 QEALTLLQNCATFKHLKQIHAKIIRNGLSHDQLLIRKLIHLCSSYGKMDYATLIFHQIQG 89 Query: 124 PSISLFNSLIRALSQHNHPLQALHSYSLMKHAQIPPDNFTF 2 P +N +I + + + +AL YSLM PPD FTF Sbjct: 90 PLTFTWNLMIMSYTINGCSQEALLLYSLMIRQGFPPDKFTF 130 >ref|XP_010246108.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770 [Nelumbo nucifera] Length = 738 Score = 73.9 bits (180), Expect = 4e-11 Identities = 41/122 (33%), Positives = 66/122 (54%), Gaps = 2/122 (1%) Frame = -3 Query: 361 LMPPLLHFPITKTNYKSIVEEIFSFLSISTTFH--HLTQLQAKVFTSGLHQNNFIATKLL 188 LM PL +P N SI + F + H HL Q+ A++ +G +N++ATK + Sbjct: 47 LMMPL-DYPDENNNLSSISSDSFYAFLLDNLTHKKHLVQIHAQLIVAGFQNSNYLATKFV 105 Query: 187 NLCSSTSSISHALLIFHHIKNPSISLFNSLIRALSQHNHPLQALHSYSLMKHAQIPPDNF 8 + S+ I +A +F I P++ L+N+++R SQ+N AL YS M+ ++ PD F Sbjct: 106 HASSNAGEIHYARSLFEEIPEPNVFLWNAIVRGYSQNNLFSDALEMYSRMQVERMNPDRF 165 Query: 7 TF 2 TF Sbjct: 166 TF 167 >ref|XP_008785897.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 [Phoenix dactylifera] Length = 537 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/110 (31%), Positives = 64/110 (58%), Gaps = 5/110 (4%) Frame = -3 Query: 316 KSIVEEIFSFLSISTTFHHLTQLQAKVFTSGLHQNNFIATKLLNLCSSTSSISHALLIFH 137 + + I L T L QL A + L Q+NF+ T+++N+C+S + +A L+F+ Sbjct: 9 RELENRIMPALRNCTNMEELKQLHAHILVFSLSQSNFLGTQIINICNSNRRVDYAALVFN 68 Query: 136 HIKNPSISLFNSLIRALSQHNHPLQALHSYSLM---KHAQ--IPPDNFTF 2 H++ P++ L+N++I+A +Q+ H +A+ Y M +HAQ + D FT+ Sbjct: 69 HVEEPNLFLYNAMIKACTQNQHCSEAISLYKQMLNRRHAQNSVLADRFTY 118