BLASTX nr result
ID: Cinnamomum23_contig00045271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00045271 (448 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010088771.1| hypothetical protein L484_018330 [Morus nota... 83 8e-14 >ref|XP_010088771.1| hypothetical protein L484_018330 [Morus notabilis] gi|587846476|gb|EXB36954.1| hypothetical protein L484_018330 [Morus notabilis] Length = 217 Score = 82.8 bits (203), Expect = 8e-14 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +3 Query: 54 HRWKGSASKPYVELPPHTAPLGMEVGPAQACAVKVVVHD 170 H WKGSASKPYVELPPHTAPLGMEVGP QACAVKVVVHD Sbjct: 57 HCWKGSASKPYVELPPHTAPLGMEVGPTQACAVKVVVHD 95