BLASTX nr result
ID: Cinnamomum23_contig00045017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00045017 (837 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008366684.1| PREDICTED: uncharacterized protein LOC103430... 63 3e-07 >ref|XP_008366684.1| PREDICTED: uncharacterized protein LOC103430323 [Malus domestica] Length = 1380 Score = 62.8 bits (151), Expect = 3e-07 Identities = 40/136 (29%), Positives = 59/136 (43%) Frame = -1 Query: 759 SNIRSSLATKVQAIPLHLHKSFKRGAPSSNTLHWKAQPDCRFTLNSACHMVRPRSSLVSW 580 SN+ S+ ++ +PL L+ + L W+ P +F+ +S H++R R S +W Sbjct: 982 SNLFPSIVQQILRLPLPLNXXXDK-------LIWEPSPTGKFSFSSGYHLIRXRHSDCAW 1034 Query: 579 AALVWYRFSLPASRLM*RVKLSLITI*CHSKLSSFGQRLMHKKTPTSSWAQSVWFSLASR 400 A ++W F P +LS RL H K PT Q SLAS Sbjct: 1035 AKVIWQHFIPP-------------------RLSILAWRLFHDKLPTEDALQRRGISLASI 1075 Query: 399 CCLHNQDSETLKHPFF 352 CCL + E+ H FF Sbjct: 1076 CCLCHNSEESTAHLFF 1091