BLASTX nr result
ID: Cinnamomum23_contig00044898
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00044898 (318 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012485014.1| PREDICTED: internal alternative NAD(P)H-ubiq... 57 5e-06 >ref|XP_012485014.1| PREDICTED: internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial-like [Gossypium raimondii] Length = 556 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/54 (51%), Positives = 38/54 (70%), Gaps = 2/54 (3%) Frame = +3 Query: 9 ISFSGND--LRLEGRSLMATLDDYSDPSANHGHDPRTRIVGGGSGKKNRGSPDA 164 IS SG++ L +EGRSLMA+++DY +P+AN GHDP +R G GS RG+ A Sbjct: 27 ISLSGDEIVLAIEGRSLMASVEDYEEPTANRGHDPPSRARGSGSNGGGRGATKA 80