BLASTX nr result
ID: Cinnamomum23_contig00044876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00044876 (668 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS49379.1| Retrovirus-related Pol polyprotein LINE-1 [Tritic... 55 3e-07 >gb|EMS49379.1| Retrovirus-related Pol polyprotein LINE-1 [Triticum urartu] Length = 882 Score = 54.7 bits (130), Expect(2) = 3e-07 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = -3 Query: 147 RPDRLCTAKCWETKQQEQAKVDVAEMHMLQGMFGVTRKDRIRNENIR 7 RP L A+CW TK++ ++DVAEM ML+ M G TRKDR+RN++IR Sbjct: 382 RPAMLYGAECWPTKRRHVQQLDVAEMCMLRCMCGHTRKDRVRNDDIR 428 Score = 26.9 bits (58), Expect(2) = 3e-07 Identities = 8/20 (40%), Positives = 16/20 (80%) Frame = -1 Query: 212 WYLGATIEQNGGFELDIVNR 153 WYLG+ ++++GG + D+ +R Sbjct: 329 WYLGSLLQEDGGIDEDVNHR 348