BLASTX nr result
ID: Cinnamomum23_contig00043352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00043352 (228 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010938746.1| PREDICTED: serine/threonine-protein kinase C... 66 1e-08 >ref|XP_010938746.1| PREDICTED: serine/threonine-protein kinase CDL1-like [Elaeis guineensis] Length = 444 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = +2 Query: 5 EAEYRPLMTDVVQSLIPLVRSQATSCPTTPSNLQHQIWTP 124 EAEYRPLM DVVQSLIPLV++ ATSCPTTPS HQI P Sbjct: 403 EAEYRPLMVDVVQSLIPLVKNPATSCPTTPSRYHHQIAIP 442