BLASTX nr result
ID: Cinnamomum23_contig00043169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00043169 (391 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK46517.1| unknown [Medicago truncatula] 69 9e-10 ref|XP_003602742.1| Sec14 cytosolic factor [Medicago truncatula]... 69 9e-10 ref|XP_002271441.1| PREDICTED: random slug protein 5 [Vitis vini... 68 2e-09 emb|CAN59728.1| hypothetical protein VITISV_037736 [Vitis vinifera] 68 2e-09 gb|ACJ85443.1| unknown [Medicago truncatula] 68 3e-09 ref|XP_009384306.1| PREDICTED: random slug protein 5-like [Musa ... 67 4e-09 ref|XP_007137847.1| hypothetical protein PHAVU_009G160800g [Phas... 67 4e-09 gb|AFK49285.1| unknown [Lotus japonicus] 67 5e-09 ref|XP_010250507.1| PREDICTED: random slug protein 5 [Nelumbo nu... 66 8e-09 gb|KFK29011.1| hypothetical protein AALP_AA7G077300 [Arabis alpina] 66 8e-09 gb|KEH20969.1| polyphosphoinositide-binding protein [Medicago tr... 66 8e-09 gb|KEH20968.1| polyphosphoinositide-binding protein [Medicago tr... 66 8e-09 gb|AAL37896.1|AF443118_1 polyphosphoinositide binding protein [G... 66 8e-09 ref|XP_009412779.1| PREDICTED: random slug protein 5-like [Musa ... 66 1e-08 gb|KFK29012.1| hypothetical protein AALP_AA7G077400 [Arabis alpina] 66 1e-08 ref|XP_006304123.1| hypothetical protein CARUB_v10010070mg [Caps... 66 1e-08 ref|XP_012090572.1| PREDICTED: random slug protein 5-like isofor... 65 1e-08 ref|XP_006844456.2| PREDICTED: random slug protein 5 isoform X1 ... 65 1e-08 gb|KHN09704.1| Random slug protein 5 [Glycine soja] 65 1e-08 ref|XP_010042672.1| PREDICTED: random slug protein 5 [Eucalyptus... 65 1e-08 >gb|AFK46517.1| unknown [Medicago truncatula] Length = 272 Score = 69.3 bits (168), Expect = 9e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDS 276 IVFVENK LK TLL++I+ESQLPEIYGGKLPLVPIQDS Sbjct: 235 IVFVENKKLKATLLEEIDESQLPEIYGGKLPLVPIQDS 272 >ref|XP_003602742.1| Sec14 cytosolic factor [Medicago truncatula] gi|355491790|gb|AES72993.1| polyphosphoinositide-binding protein [Medicago truncatula] gi|388521721|gb|AFK48922.1| unknown [Medicago truncatula] Length = 272 Score = 69.3 bits (168), Expect = 9e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDS 276 IVFVENK LK TLL++I+ESQLPEIYGGKLPLVPIQDS Sbjct: 235 IVFVENKKLKATLLEEIDESQLPEIYGGKLPLVPIQDS 272 >ref|XP_002271441.1| PREDICTED: random slug protein 5 [Vitis vinifera] gi|296085533|emb|CBI29265.3| unnamed protein product [Vitis vinifera] Length = 246 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDS 276 I+FVENKN+K TLL DI+E+QLP++YGGKLPLVPIQDS Sbjct: 209 IIFVENKNIKSTLLGDIDENQLPDVYGGKLPLVPIQDS 246 >emb|CAN59728.1| hypothetical protein VITISV_037736 [Vitis vinifera] Length = 218 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDS 276 I+FVENKN+K TLL DI+E+QLP++YGGKLPLVPIQDS Sbjct: 181 IIFVENKNIKSTLLGDIDENQLPDVYGGKLPLVPIQDS 218 >gb|ACJ85443.1| unknown [Medicago truncatula] Length = 272 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDS 276 IVFVENK L+ TLL++I+ESQLPEIYGGKLPLVPIQDS Sbjct: 235 IVFVENKKLEATLLEEIDESQLPEIYGGKLPLVPIQDS 272 >ref|XP_009384306.1| PREDICTED: random slug protein 5-like [Musa acuminata subsp. malaccensis] Length = 246 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/39 (71%), Positives = 38/39 (97%) Frame = -3 Query: 386 VFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDSTV 270 +F+ENK+LK TLL++I+ESQLPEIYGGKLPLVP+++ST+ Sbjct: 208 IFIENKDLKATLLEEIDESQLPEIYGGKLPLVPVEESTI 246 >ref|XP_007137847.1| hypothetical protein PHAVU_009G160800g [Phaseolus vulgaris] gi|561010934|gb|ESW09841.1| hypothetical protein PHAVU_009G160800g [Phaseolus vulgaris] Length = 264 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDS 276 IVFVENK LK TLL++IEESQLP+IYGG++PLVPIQDS Sbjct: 227 IVFVENKKLKSTLLEEIEESQLPDIYGGQMPLVPIQDS 264 >gb|AFK49285.1| unknown [Lotus japonicus] Length = 110 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDS 276 IVFV+NK LK TLL++I+ESQLPEIYGG+LPLVPIQDS Sbjct: 73 IVFVDNKKLKSTLLEEIDESQLPEIYGGQLPLVPIQDS 110 >ref|XP_010250507.1| PREDICTED: random slug protein 5 [Nelumbo nucifera] Length = 251 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDS 276 IVF+E+K LK TLL+DI+E+QLPEIYGGKLPLVPIQ+S Sbjct: 214 IVFIESKKLKSTLLEDIDENQLPEIYGGKLPLVPIQES 251 >gb|KFK29011.1| hypothetical protein AALP_AA7G077300 [Arabis alpina] Length = 244 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDS 276 IVFVE KNL TLL+DI+ESQLP+IYGGKLP+VPIQDS Sbjct: 207 IVFVEKKNLTATLLEDIDESQLPDIYGGKLPVVPIQDS 244 >gb|KEH20969.1| polyphosphoinositide-binding protein [Medicago truncatula] Length = 263 Score = 66.2 bits (160), Expect = 8e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDS 276 IVFVEN LK TLL+DI+ESQLPEIYGGKL LVPIQDS Sbjct: 225 IVFVENNKLKSTLLEDIDESQLPEIYGGKLQLVPIQDS 262 >gb|KEH20968.1| polyphosphoinositide-binding protein [Medicago truncatula] Length = 253 Score = 66.2 bits (160), Expect = 8e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDS 276 IVFVEN LK TLL+DI+ESQLPEIYGGKL LVPIQDS Sbjct: 215 IVFVENNKLKSTLLEDIDESQLPEIYGGKLQLVPIQDS 252 >gb|AAL37896.1|AF443118_1 polyphosphoinositide binding protein [Gossypium hirsutum] Length = 247 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDS 276 IVFVENK+LK TLL++I+ESQLPE+YGG LPL+PIQDS Sbjct: 210 IVFVENKSLKSTLLEEIDESQLPEMYGGTLPLIPIQDS 247 >ref|XP_009412779.1| PREDICTED: random slug protein 5-like [Musa acuminata subsp. malaccensis] Length = 253 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/40 (72%), Positives = 37/40 (92%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDSTV 270 IVFVENKNLK TL++DIEESQ+P+ YGG+LPL+PI+ ST+ Sbjct: 214 IVFVENKNLKATLMKDIEESQIPQTYGGELPLIPIEKSTM 253 >gb|KFK29012.1| hypothetical protein AALP_AA7G077400 [Arabis alpina] Length = 248 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDS 276 I+FVE KNL TLL+DI+ESQLP+IYGGKLP+VPIQDS Sbjct: 211 IIFVEKKNLTATLLEDIDESQLPDIYGGKLPVVPIQDS 248 >ref|XP_006304123.1| hypothetical protein CARUB_v10010070mg [Capsella rubella] gi|482572834|gb|EOA37021.1| hypothetical protein CARUB_v10010070mg [Capsella rubella] Length = 255 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDS 276 IVFVENK L TLLQDI+ESQLP+IYGGKLPLVPIQ++ Sbjct: 218 IVFVENKKLTPTLLQDIDESQLPDIYGGKLPLVPIQET 255 >ref|XP_012090572.1| PREDICTED: random slug protein 5-like isoform X1 [Jatropha curcas] Length = 247 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDS 276 IVFVENK LK TLL+DI+ESQ+PEIYGGK+ LVPIQD+ Sbjct: 210 IVFVENKKLKSTLLEDIDESQIPEIYGGKMSLVPIQDN 247 >ref|XP_006844456.2| PREDICTED: random slug protein 5 isoform X1 [Amborella trichopoda] Length = 250 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDST 273 IVFVENKN + LL +I+ESQLPEIYGGKLPL+PIQDS+ Sbjct: 211 IVFVENKNQQSVLLNEIDESQLPEIYGGKLPLIPIQDSS 249 >gb|KHN09704.1| Random slug protein 5 [Glycine soja] Length = 265 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDS 276 IVFVENK LK TLL++IEESQLP+IYGG++PLVPIQ+S Sbjct: 228 IVFVENKKLKSTLLEEIEESQLPDIYGGQMPLVPIQNS 265 >ref|XP_010042672.1| PREDICTED: random slug protein 5 [Eucalyptus grandis] Length = 281 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -3 Query: 389 IVFVENKNLKETLLQDIEESQLPEIYGGKLPLVPIQDS 276 IVFVENK L+ TLL DI+ESQLP++YGG+LPLVPIQDS Sbjct: 244 IVFVENKKLRTTLLGDIDESQLPDVYGGRLPLVPIQDS 281