BLASTX nr result
ID: Cinnamomum23_contig00042933
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00042933 (245 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010275835.1| PREDICTED: pentatricopeptide repeat-containi... 100 6e-19 ref|XP_004501051.1| PREDICTED: pentatricopeptide repeat-containi... 93 8e-17 ref|XP_010048595.1| PREDICTED: pentatricopeptide repeat-containi... 92 1e-16 ref|XP_010646933.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 gb|AES73969.2| PPR containing plant-like protein [Medicago trunc... 89 1e-15 ref|XP_003603718.1| Pentatricopeptide repeat protein [Medicago t... 89 1e-15 ref|XP_010646822.1| PREDICTED: pentatricopeptide repeat-containi... 89 1e-15 ref|XP_010646821.1| PREDICTED: pentatricopeptide repeat-containi... 89 1e-15 ref|XP_003629888.1| Pentatricopeptide repeat protein [Medicago t... 89 1e-15 ref|XP_011626235.1| PREDICTED: pentatricopeptide repeat-containi... 88 2e-15 ref|XP_009388055.1| PREDICTED: pentatricopeptide repeat-containi... 88 2e-15 ref|XP_008223786.1| PREDICTED: pentatricopeptide repeat-containi... 88 2e-15 ref|XP_010914156.1| PREDICTED: pentatricopeptide repeat-containi... 86 7e-15 ref|XP_002531032.1| pentatricopeptide repeat-containing protein,... 86 1e-14 ref|XP_009336183.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 ref|XP_007226519.1| hypothetical protein PRUPE_ppa025518mg [Prun... 85 2e-14 ref|XP_010094224.1| hypothetical protein L484_016768 [Morus nota... 84 4e-14 ref|XP_011626236.1| PREDICTED: pentatricopeptide repeat-containi... 84 5e-14 ref|XP_007139632.1| hypothetical protein PHAVU_008G046100g [Phas... 84 5e-14 ref|XP_011031925.1| PREDICTED: pentatricopeptide repeat-containi... 83 6e-14 >ref|XP_010275835.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nelumbo nucifera] Length = 548 Score = 99.8 bits (247), Expect = 6e-19 Identities = 46/72 (63%), Positives = 60/72 (83%) Frame = +2 Query: 20 VSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMISGYVQNKC 199 ++RQ+F+++PN+N+V SLISGYC G V EA +FD+MP+R+DVSWSA+ISGYVQN C Sbjct: 189 LARQIFEEAPNRNIVCWTSLISGYCSHGLVDEARILFDKMPDRNDVSWSAIISGYVQNDC 248 Query: 200 HTEAIELFRELK 235 EAIELF+ELK Sbjct: 249 FNEAIELFQELK 260 >ref|XP_004501051.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cicer arietinum] Length = 534 Score = 92.8 bits (229), Expect = 8e-17 Identities = 46/81 (56%), Positives = 63/81 (77%), Gaps = 1/81 (1%) Frame = +2 Query: 2 SKH-DVGVSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMIS 178 SKH ++ ++RQ+FD+S N+NVV SL+SGYC G V EA ++FDEMP ++D S+SAM+S Sbjct: 151 SKHGEINLARQVFDESSNRNVVCWTSLVSGYCSCGLVNEARDLFDEMPNKNDSSFSAMVS 210 Query: 179 GYVQNKCHTEAIELFRELKQK 241 GYV+N E I+LFRELK+K Sbjct: 211 GYVRNGFFNEGIQLFRELKKK 231 >ref|XP_010048595.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Eucalyptus grandis] gi|629116216|gb|KCW80891.1| hypothetical protein EUGRSUZ_C02259 [Eucalyptus grandis] Length = 480 Score = 92.0 bits (227), Expect = 1e-16 Identities = 48/82 (58%), Positives = 62/82 (75%), Gaps = 1/82 (1%) Frame = +2 Query: 2 SKHD-VGVSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMIS 178 SKH V +R+LFD+SP +NVV SLI+GYC G V EA +FD +PE++DVS+SAMIS Sbjct: 150 SKHGAVSAARRLFDQSPVRNVVCWTSLITGYCSSGLVNEARELFDSVPEKNDVSYSAMIS 209 Query: 179 GYVQNKCHTEAIELFRELKQKA 244 GYV+N+ EAIELF E+K +A Sbjct: 210 GYVRNERFDEAIELFSEVKDRA 231 >ref|XP_010646933.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 528 Score = 91.3 bits (225), Expect = 2e-16 Identities = 46/75 (61%), Positives = 56/75 (74%) Frame = +2 Query: 20 VSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMISGYVQNKC 199 ++RQ+F++S N+N+V LISGYC G V EA VFD MPER+DVS+SAM SGYV+N C Sbjct: 161 LARQVFNESSNRNIVCWTGLISGYCSNGFVDEARCVFDAMPERNDVSYSAMASGYVRNDC 220 Query: 200 HTEAIELFRELKQKA 244 EAIELFREL A Sbjct: 221 FNEAIELFRELNSCA 235 >gb|AES73969.2| PPR containing plant-like protein [Medicago truncatula] Length = 524 Score = 89.0 bits (219), Expect = 1e-15 Identities = 44/81 (54%), Positives = 62/81 (76%), Gaps = 1/81 (1%) Frame = +2 Query: 2 SKHD-VGVSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMIS 178 SKH + ++RQ+FD+S N+NVV SL+SGYC G V E +VFD+MP+R++ S SAM+S Sbjct: 151 SKHGAIHLARQVFDESSNRNVVCWTSLVSGYCSCGLVNEVRDVFDKMPQRNEASNSAMVS 210 Query: 179 GYVQNKCHTEAIELFRELKQK 241 GYV+N +E ++LFRELK+K Sbjct: 211 GYVRNSFFSEGVQLFRELKKK 231 >ref|XP_003603718.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 629 Score = 89.0 bits (219), Expect = 1e-15 Identities = 44/81 (54%), Positives = 62/81 (76%), Gaps = 1/81 (1%) Frame = +2 Query: 2 SKHD-VGVSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMIS 178 SKH + ++RQ+FD+S N+NVV SL+SGYC G V E +VFD+MP+R++ S SAM+S Sbjct: 167 SKHGAIHLARQVFDESSNRNVVCWTSLVSGYCSCGLVNEVRDVFDKMPQRNEASNSAMVS 226 Query: 179 GYVQNKCHTEAIELFRELKQK 241 GYV+N +E ++LFRELK+K Sbjct: 227 GYVRNSFFSEGVQLFRELKKK 247 >ref|XP_010646822.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like isoform X2 [Vitis vinifera] Length = 474 Score = 88.6 bits (218), Expect = 1e-15 Identities = 46/75 (61%), Positives = 56/75 (74%) Frame = +2 Query: 20 VSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMISGYVQNKC 199 ++RQ+F++S N+N+V LISGYC G V EA VFD MPER+DVS+SAM SGYV+N Sbjct: 161 LARQVFNESSNRNIVCWTGLISGYCSNGFVDEARCVFDAMPERNDVSYSAMASGYVRNDR 220 Query: 200 HTEAIELFRELKQKA 244 EAIELFRELK A Sbjct: 221 FNEAIELFRELKSCA 235 >ref|XP_010646821.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like isoform X1 [Vitis vinifera] Length = 528 Score = 88.6 bits (218), Expect = 1e-15 Identities = 46/75 (61%), Positives = 56/75 (74%) Frame = +2 Query: 20 VSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMISGYVQNKC 199 ++RQ+F++S N+N+V LISGYC G V EA VFD MPER+DVS+SAM SGYV+N Sbjct: 161 LARQVFNESSNRNIVCWTGLISGYCSNGFVDEARCVFDAMPERNDVSYSAMASGYVRNDR 220 Query: 200 HTEAIELFRELKQKA 244 EAIELFRELK A Sbjct: 221 FNEAIELFRELKSCA 235 >ref|XP_003629888.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355523910|gb|AET04364.1| PPR containing plant-like protein [Medicago truncatula] Length = 515 Score = 88.6 bits (218), Expect = 1e-15 Identities = 44/81 (54%), Positives = 62/81 (76%), Gaps = 1/81 (1%) Frame = +2 Query: 2 SKHD-VGVSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMIS 178 SKH + ++RQ+FD+ N+NVV SL+SGYC G V EA +VFD+MP R++ S+SAM+S Sbjct: 131 SKHSAIHLARQVFDECSNRNVVCWTSLVSGYCSCGLVNEARDVFDKMPLRNEASYSAMVS 190 Query: 179 GYVQNKCHTEAIELFRELKQK 241 GYV+N +E ++LFRELK+K Sbjct: 191 GYVRNGFFSEGVQLFRELKKK 211 >ref|XP_011626235.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Amborella trichopoda] Length = 542 Score = 88.2 bits (217), Expect = 2e-15 Identities = 42/76 (55%), Positives = 55/76 (72%) Frame = +2 Query: 11 DVGVSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMISGYVQ 190 D+ +RQ+FD+ +N+V SL+SGYC G V EA VF+EM ER++V WSAMISGY Q Sbjct: 165 DIEYARQVFDRMSFRNLVIYSSLVSGYCACGHVDEAREVFNEMSERNEVVWSAMISGYAQ 224 Query: 191 NKCHTEAIELFRELKQ 238 N C EAI+LF EL++ Sbjct: 225 NGCFQEAIDLFHELRE 240 >ref|XP_009388055.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Musa acuminata subsp. malaccensis] Length = 490 Score = 88.2 bits (217), Expect = 2e-15 Identities = 41/75 (54%), Positives = 58/75 (77%) Frame = +2 Query: 14 VGVSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMISGYVQN 193 V ++ ++FD+S ++NVV SL++GYC G V +A ++FD MPER+ SWSAMI+GYVQN Sbjct: 150 VQLASKVFDESSHRNVVCWTSLVTGYCSHGLVDKARSLFDHMPERNGASWSAMITGYVQN 209 Query: 194 KCHTEAIELFRELKQ 238 + H EAIELF EL++ Sbjct: 210 ERHKEAIELFHELRE 224 >ref|XP_008223786.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Prunus mume] Length = 528 Score = 88.2 bits (217), Expect = 2e-15 Identities = 44/74 (59%), Positives = 56/74 (75%) Frame = +2 Query: 14 VGVSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMISGYVQN 193 V +R++F++S +KNV SLISGYC G V EA ++FD MPER+DVS+SAM+SGYV N Sbjct: 160 VEFARRVFEESLDKNVACWTSLISGYCSNGLVHEARDLFDAMPERNDVSYSAMVSGYVWN 219 Query: 194 KCHTEAIELFRELK 235 C EAI+LFRE K Sbjct: 220 ACFNEAIDLFRESK 233 >ref|XP_010914156.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Elaeis guineensis] Length = 553 Score = 86.3 bits (212), Expect = 7e-15 Identities = 43/69 (62%), Positives = 51/69 (73%) Frame = +2 Query: 29 QLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMISGYVQNKCHTE 208 Q+FD+S N+N+V SLIS +C G V A FD M ER+DVSWSAMI+GYVQN+ E Sbjct: 188 QVFDESSNRNIVCWTSLISAHCAHGLVDRAREFFDRMAERNDVSWSAMITGYVQNERPEE 247 Query: 209 AIELFRELK 235 AIELFRELK Sbjct: 248 AIELFRELK 256 >ref|XP_002531032.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529385|gb|EEF31349.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 392 Score = 85.5 bits (210), Expect = 1e-14 Identities = 45/79 (56%), Positives = 58/79 (73%), Gaps = 1/79 (1%) Frame = +2 Query: 2 SKHD-VGVSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMIS 178 SKH V +RQ+FD+S + NVV SLISG C+ G + EA +FD MPER++VS+SAM+S Sbjct: 154 SKHGAVEYARQVFDESSDTNVVCWTSLISGCCINGLIDEAREMFDRMPERNEVSYSAMVS 213 Query: 179 GYVQNKCHTEAIELFRELK 235 G+V+N EAI LFRELK Sbjct: 214 GFVRNGFFNEAIALFRELK 232 >ref|XP_009336183.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Pyrus x bretschneideri] gi|694416102|ref|XP_009336184.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Pyrus x bretschneideri] Length = 530 Score = 85.1 bits (209), Expect = 2e-14 Identities = 42/74 (56%), Positives = 57/74 (77%) Frame = +2 Query: 14 VGVSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMISGYVQN 193 V +R++F++S +KNVV SLISGYC G V EA ++F+ MP+ +DVS+SAM+SGYV N Sbjct: 160 VEFARRVFEESLDKNVVCWTSLISGYCSNGLVHEARDLFEAMPDINDVSYSAMVSGYVGN 219 Query: 194 KCHTEAIELFRELK 235 C EAI+LFR+LK Sbjct: 220 ACFNEAIDLFRQLK 233 >ref|XP_007226519.1| hypothetical protein PRUPE_ppa025518mg [Prunus persica] gi|462423455|gb|EMJ27718.1| hypothetical protein PRUPE_ppa025518mg [Prunus persica] Length = 528 Score = 85.1 bits (209), Expect = 2e-14 Identities = 42/74 (56%), Positives = 56/74 (75%) Frame = +2 Query: 14 VGVSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMISGYVQN 193 V +R++F++S +KN+ SLISGYC G V EA ++FD MPER++VS+SAM+SGYV N Sbjct: 160 VEFARRVFEESLDKNLACWTSLISGYCSNGLVHEARDLFDAMPERNNVSYSAMVSGYVWN 219 Query: 194 KCHTEAIELFRELK 235 C EAI+LFRE K Sbjct: 220 ACFNEAIDLFRESK 233 >ref|XP_010094224.1| hypothetical protein L484_016768 [Morus notabilis] gi|587865884|gb|EXB55400.1| hypothetical protein L484_016768 [Morus notabilis] Length = 508 Score = 84.0 bits (206), Expect = 4e-14 Identities = 45/73 (61%), Positives = 55/73 (75%), Gaps = 1/73 (1%) Frame = +2 Query: 23 SRQLFDKS-PNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMISGYVQNKC 199 +R++FD+ NVV SL+SGYC+ G V EA VFDEMPER+DVS+SAM+SGYV N C Sbjct: 139 ARRVFDERIETTNVVCWTSLLSGYCLNGLVDEACLVFDEMPERNDVSYSAMVSGYVSNGC 198 Query: 200 HTEAIELFRELKQ 238 EAI LFRELK+ Sbjct: 199 FYEAILLFRELKK 211 >ref|XP_011626236.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Amborella trichopoda] Length = 514 Score = 83.6 bits (205), Expect = 5e-14 Identities = 41/76 (53%), Positives = 54/76 (71%) Frame = +2 Query: 11 DVGVSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMISGYVQ 190 D+ + Q+FD+ +N+V SLISGYC G V EA VF+EM ER++V WSAMISGY Q Sbjct: 138 DIENALQVFDRMSFRNIVVYSSLISGYCACGLVDEAREVFNEMSERNEVVWSAMISGYAQ 197 Query: 191 NKCHTEAIELFRELKQ 238 N C EAI+LF +L++ Sbjct: 198 NGCFQEAIDLFHKLRE 213 >ref|XP_007139632.1| hypothetical protein PHAVU_008G046100g [Phaseolus vulgaris] gi|561012765|gb|ESW11626.1| hypothetical protein PHAVU_008G046100g [Phaseolus vulgaris] Length = 602 Score = 83.6 bits (205), Expect = 5e-14 Identities = 40/74 (54%), Positives = 54/74 (72%) Frame = +2 Query: 14 VGVSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMISGYVQN 193 VG++R+LFDK KNVVS S+ISGYC G V A +FD MP+++ +W+AMI GY QN Sbjct: 240 VGLARELFDKMGEKNVVSWTSMISGYCGNGDVENARLMFDAMPDKNLFTWNAMIGGYCQN 299 Query: 194 KCHTEAIELFRELK 235 + EA+ELFRE++ Sbjct: 300 RRSHEALELFREMQ 313 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/61 (44%), Positives = 43/61 (70%) Frame = +2 Query: 11 DVGVSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMISGYVQ 190 D+G +R+LFD+ +++VV+ ++I GY G V A +FD+M E++ VSW++MISGY Sbjct: 208 DMGEARRLFDEMEDRDVVAFNAMIDGYAKTGCVGLARELFDKMGEKNVVSWTSMISGYCG 267 Query: 191 N 193 N Sbjct: 268 N 268 >ref|XP_011031925.1| PREDICTED: pentatricopeptide repeat-containing protein At2g44880 [Populus euphratica] Length = 595 Score = 83.2 bits (204), Expect = 6e-14 Identities = 40/75 (53%), Positives = 54/75 (72%) Frame = +2 Query: 11 DVGVSRQLFDKSPNKNVVS*MSLISGYCVQGQVVEAHNVFDEMPERSDVSWSAMISGYVQ 190 D+ +R LFD+ P +NV+S S+I GYC G V+ A +FD MPE++ VSW+AMI GY Q Sbjct: 228 DMESARSLFDEMPERNVISWTSMIYGYCNNGDVLSARFLFDAMPEKNLVSWNAMIGGYCQ 287 Query: 191 NKCHTEAIELFRELK 235 NK EA++LFREL+ Sbjct: 288 NKQPHEALKLFRELQ 302