BLASTX nr result
ID: Cinnamomum23_contig00042853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00042853 (265 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS56299.1| Polycomb group protein EMBRYONIC FLOWER 2 [Tritic... 57 6e-06 >gb|EMS56299.1| Polycomb group protein EMBRYONIC FLOWER 2 [Triticum urartu] Length = 974 Score = 56.6 bits (135), Expect = 6e-06 Identities = 37/88 (42%), Positives = 51/88 (57%), Gaps = 2/88 (2%) Frame = +2 Query: 8 QITRKYREK*KNLHMKVFIKSRESL*QCT*RFALVILNKRSIPRGYIEIIKDMYERAVTS 187 Q+ ++YRE+ K+LHM VFI ++ + L K +P YI +IKDMY+ VTS Sbjct: 75 QLMKRYREQKKDLHM-VFIDLEKAYDKIPRNVMWWALEKHKVPTKYITLIKDMYDNVVTS 133 Query: 188 VRTTYRAIGEF--LVP*VWGLALSPYLF 265 VRT+ I +F + G ALSPYLF Sbjct: 134 VRTSDVDIDDFPIKIGLHQGSALSPYLF 161