BLASTX nr result
ID: Cinnamomum23_contig00042335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00042335 (252 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010249397.1| PREDICTED: endoribonuclease Dicer homolog 2 ... 57 6e-06 >ref|XP_010249397.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Nelumbo nucifera] Length = 1394 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 92 DPETFARSYQLEALEKSLRENTIAFLETGS 3 DP TFARSYQLEALEK++RENTIAFLETGS Sbjct: 14 DPLTFARSYQLEALEKAMRENTIAFLETGS 43